Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS06655 [old locus tag: SA1171 ]
- pan locus tag?: SAUPAN003709000
- symbol: SA_RS06655
- pan gene symbol?: rpsN2
- synonym:
- product: 30S ribosomal protein S14
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA_RS06655 [old locus tag: SA1171 ]
- symbol: SA_RS06655
- product: 30S ribosomal protein S14
- replicon: chromosome
- strand: +
- coordinates: 1334310..1334579
- length: 270
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGGCTAAGAAATCTAAAATAGCAAAAGAGAGAAAAAGAGAAGAGTTAGTAAATAAATAT
TACGAATTACGTAAAGAGTTAAAAGCAAAAGGTGATTACGAAGCGTTAAGAAAATTACCA
AGAGATTCATCACCTACACGTTTAACTAGAAGATGTAAAGTAACTGGAAGACCTAGAGGT
GTATTACGTAAATTTGAAATGTCTCGTATTGCGTTTAGAGAACATGCGCACAAAGGACAA
ATTCCAGGTGTTAAAAAATCAAGTTGGTAA60
120
180
240
270
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA_RS06655 [old locus tag: SA1171 ]
- symbol: SA_RS06655
- description: 30S ribosomal protein S14
- length: 89
- theoretical pI: 11.4256
- theoretical MW: 10540.3
- GRAVY: -1.18989
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SA1171
- PFAM: no clan defined Ribosomal_S14; Ribosomal protein S14p/S29e (PF00253; HMM-score: 97.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.013347
- TAT(Tat/SPI): 0.00948
- LIPO(Sec/SPII): 0.00334
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MAKKSKIAKERKREELVNKYYELRKELKAKGDYEALRKLPRDSSPTRLTRRCKVTGRPRGVLRKFEMSRIAFREHAHKGQIPGVKKSSW
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
SA_RS01275 formate acetyltransferase [1] (data from MRSA252) SA_RS01365 L-lactate dehydrogenase [1] (data from MRSA252) SA_RS01710 5'-nucleotidase, lipoprotein e(P4) family [1] (data from MRSA252) SA_RS02015 30S ribosomal protein S6 [1] (data from MRSA252) SA_RS02025 30S ribosomal protein S18 [1] (data from MRSA252) SA_RS02145 IMP dehydrogenase [1] (data from MRSA252) SA_RS02150 GMP synthase (glutamine-hydrolyzing) [1] (data from MRSA252) SA_RS02810 pyridoxal 5'-phosphate synthase lyase subunit PdxS [1] (data from MRSA252) SA_RS02905 50S ribosomal protein L11 [1] (data from MRSA252) SA_RS02910 50S ribosomal protein L1 [1] (data from MRSA252) SA_RS02915 50S ribosomal protein L10 [1] (data from MRSA252) SA_RS02925 methyltransferase [1] (data from MRSA252) SA_RS02950 30S ribosomal protein S7 [1] (data from MRSA252) SA_RS02955 elongation factor G [1] (data from MRSA252) SA_RS03155 phosphate acetyltransferase [1] (data from MRSA252) SA_RS03475 dihydroxyacetone kinase subunit DhaK [1] (data from MRSA252) SA_RS03645 hypothetical protein [1] (data from MRSA252) SA_RS04140 aldehyde dehydrogenase [1] (data from MRSA252) SA_RS04160 enolase [1] (data from MRSA252) SA_RS04330 glycine cleavage system protein H [1] (data from MRSA252) SA_RS04865 oligoendopeptidase F [1] (data from MRSA252) SA_RS05295 phosphocarrier protein HPr [1] (data from MRSA252) SA_RS05325 ribonuclease J 1 [1] (data from MRSA252) SA_RS05350 pyruvate dehydrogenase E1 component subunit alpha [1] (data from MRSA252) SA_RS05855 cell division protein FtsA [1] (data from MRSA252) SA_RS06085 beta-ketoacyl-ACP reductase [1] (data from MRSA252) SA_RS06140 50S ribosomal protein L19 [1] (data from MRSA252) SA_RS06315 30S ribosomal protein S15 [1] (data from MRSA252) SA_RS06325 ribonuclease J 2 [1] (data from MRSA252) SA_RS06490 glutamine synthetase [1] (data from MRSA252) SA_RS06730 aconitate hydratase [1] (data from MRSA252) SA_RS07385 DNA-binding protein HU [1] (data from MRSA252) SA_RS07400 30S ribosomal protein S1 [1] (data from MRSA252) SA_RS07985 30S ribosomal protein S20 [1] (data from MRSA252) SA_RS08135 hypothetical protein [1] (data from MRSA252) SA_RS08295 50S ribosomal protein L21 [1] (data from MRSA252) SA_RS08435 trigger factor [1] (data from MRSA252) SA_RS08465 50S ribosomal protein L35 [1] (data from MRSA252) SA_RS08470 translation initiation factor IF-3 [1] (data from MRSA252) SA_RS08560 pyruvate kinase [1] (data from MRSA252) SA_RS08600 universal stress protein [1] (data from MRSA252) SA_RS08630 acetate kinase [1] (data from MRSA252) SA_RS08675 30S ribosomal protein S4 [1] (data from MRSA252) SA_RS08760 formate--tetrahydrofolate ligase [1] (data from MRSA252) SA_RS09810 non-heme ferritin [1] (data from MRSA252) SA_RS10020 ABC transporter ATP-binding protein [1] (data from MRSA252) SA_RS10535 molecular chaperone GroEL [1] (data from MRSA252) SA_RS11245 glutamine--fructose-6-phosphate aminotransferase [1] (data from MRSA252) SA_RS11430 Asp23/Gls24 family envelope stress response protein [1] (data from MRSA252) SA_RS11600 30S ribosomal protein S9 [1] (data from MRSA252) SA_RS11630 50S ribosomal protein L17 [1] (data from MRSA252) SA_RS11640 30S ribosomal protein S11 [1] (data from MRSA252) SA_RS11645 30S ribosomal protein S13 [1] (data from MRSA252) SA_RS11680 30S ribosomal protein S5 [1] (data from MRSA252) SA_RS11690 50S ribosomal protein L6 [1] (data from MRSA252) SA_RS11720 30S ribosomal protein S17 [1] (data from MRSA252) SA_RS11730 50S ribosomal protein L16 [1] (data from MRSA252) SA_RS11735 30S ribosomal protein S3 [1] (data from MRSA252) SA_RS11745 30S ribosomal protein S19 [1] (data from MRSA252) SA_RS11750 50S ribosomal protein L2 [1] (data from MRSA252) SA_RS11755 50S ribosomal protein L23 [1] (data from MRSA252) SA_RS11760 50S ribosomal protein L4 [1] (data from MRSA252) SA_RS11770 30S ribosomal protein S10 [1] (data from MRSA252) SA_RS13375 hydroxymethylglutaryl-CoA synthase [1] (data from MRSA252) SA_RS13730 class I fructose-bisphosphate aldolase [1] (data from MRSA252) SA_RS13735 malate:quinone oxidoreductase [1] (data from MRSA252) SA_RS13915 ornithine carbamoyltransferase [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: Zur* see SA1171
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 1.45 1.46 1.47 1.48 1.49 1.50 1.51 1.52 1.53 1.54 1.55 1.56 1.57 1.58 1.59 1.60 1.61 1.62 1.63 1.64 1.65 1.66 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]