From AureoWiki
Jump to navigation Jump to search
COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0356 [new locus tag: SACOL_RS01790 ]
  • pan locus tag?:
  • symbol: SACOL0356
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0356 [new locus tag: SACOL_RS01790 ]
  • symbol: SACOL0356
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 370745..370981
  • length: 237
  • essential: unknown

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGAATAATCGCGAAAAAATCGAACAGTCCGTTATTAGTGCTAGTGCGTATAACGGTAAT
    GACACAGAGGGGTTGCTAAAAGAGATTGAGGACGTGTATAAGAAAGCGCAAGCGTTTGAT
    GAAATACTTGAGGGAATGACAAATGCTATTCAACATTCAGTTAAAGAAGGTATTGAACTT
    GATGAAGCAGTAGGGATTATGGCAGGTCAAGTTGTCTATAAATATGAGGAGGAATAG
    60
    120
    180
    237

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL0356 [new locus tag: SACOL_RS01790 ]
  • symbol: SACOL0356
  • description: hypothetical protein
  • length: 78
  • theoretical pI: 4.02927
  • theoretical MW: 8725.62
  • GRAVY: -0.529487

Function[edit | edit source]

  • TIGRFAM:
    hercynine metabolism small protein (TIGR04374; HMM-score: 14.4)
  • TheSEED  :
    • Phage phi 11 orf23 protein homolog
  • PFAM:
    no clan defined DUF1024; Protein of unknown function (DUF1024) (PF06260; HMM-score: 177.3)
    and 1 more
    WbqC; WbqC-like protein family (PF08889; HMM-score: 13.1)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.010818
    • TAT(Tat/SPI): 0.001132
    • LIPO(Sec/SPII): 0.000843
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MNNREKIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEGMTNAIQHSVKEGIELDEAVGIMAGQVVYKYEEE

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell: 65 [1]
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]