Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS06365 [old locus tag: NWMN_1127 ]
  • pan locus tag?: SAUPAN003500000
  • symbol: NWMN_RS06365
  • pan gene symbol?: sun
  • synonym:
  • product: 16S rRNA (cytosine(967)-C(5))-methyltransferase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS06365 [old locus tag: NWMN_1127 ]
  • symbol: NWMN_RS06365
  • product: 16S rRNA (cytosine(967)-C(5))-methyltransferase
  • replicon: chromosome
  • strand: +
  • coordinates: 1235009..1236316
  • length: 1308
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (1235009..1236316) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    1201
    1261
    ATGATAGAAAACGTGAGAAGTCTTGCTTTTGACACGATTCAAGATATATTAAATGAAGGT
    GCGTATAGTAACTTGCGTATCAATGAAGTGTTGTCAGAAAATGAATTAAATGCAATGGAT
    AAGGCTTTATTTACAGAAATTGTCTACGGAACCGTTAAAAGAAAATATACGTTAGATTTT
    TATTTAAAGCCTTTTGTGAAAACAAAGATTAAGGCATGGGTTAGGCAATTATTATGGATG
    AGTATTTATCAATATGTTTATTTAGATAAAGTTCCAAATCATGCCATTATTAATGAAGCA
    GTTGAAATAGCAAAAGAACGCGGTGGCTATCATAATGGTAATGTCGTAAATGGTATTTTA
    CGTACAATGATGCGTAGTGACTTACCTGATTTTAATGAAATTGCAGATCCTAAAAAAAGA
    ATGGCAATCGAGTATAGTATGCCGAAGTGGATTATAGATCATTGGGCAACACATTATGGT
    CTCGAAGAAACTGAAACAATTTTACAGTCATTTTTAGAAACGACATCAACAACTGTGCGT
    GCCAACCTGACGCGAGCATCATTAGATGATATTATTGAAAAGTTGCAAGACGAAGGTTAT
    GACGTTGAAAAAGATCATGACTTACCTTATTGTCTCCATATAGGAGGACAACCAATTATT
    CATTCTCGTTCATTTAAAGATGGATTCGTTTCAATTCAAGATAAAAGCTCAATGTTTGTT
    GCACACATTATGAATGTAGACCGACATGATCACGTATTAGATGCATGTAGTGCACCTGGC
    GGTAAAGCTTGTCACATTGCTGAAGTTTTAATGCCAGAAGGGCAAGTTGACGCTTCAGAT
    ATACATGATCACAAAATAGACTTAATTAATTTTAATATAAAAAAATTACGATTAACAAAT
    ATTAAAGCTTTTCAACATGATGCGACAAAACCTTATGATAAAACATACGATAAGATACTT
    GTTGATGCACCATGTAGCGGATTAGGTGTAATGAGACATAAGCCGGAGATTAAGTATACT
    CAAAGCAAACAACATATTGAGTCACTAGTTGAATTACAGCTTGAAATATTGGAAAATGTA
    AAAAACAATGTAAAAATAGGTGGCGAAATCATCTATTCAACATGTACAATTGAGCAACTA
    GAAAATGAAAACGTGATTTATACGTTTTTGAAAAATAATAAAAACTTCGAATTTGAACCG
    TTTCAACATCCGATAACTGGAGAGTTGGTCAAAACGTTACAAATCATGCCGCAAGACTTT
    AATTCAGATGGATTCTTTATCACTAAGATAAAAAGAAAGGACAATTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1200
    1260
    1308

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS06365 [old locus tag: NWMN_1127 ]
  • symbol: NWMN_RS06365
  • description: 16S rRNA (cytosine(967)-C(5))-methyltransferase
  • length: 435
  • theoretical pI: 6.06131
  • theoretical MW: 50086.9
  • GRAVY: -0.368736

Function[edit source | edit]

  • reaction:
    EC 2.1.1.-?  ExPASy
  • TIGRFAM:
    Genetic information processingProtein synthesistRNA and rRNA base modification16S rRNA (cytosine(967)-C(5))-methyltransferase (TIGR00563; EC 2.1.1.176; HMM-score: 394.4)
    Genetic information processingProtein synthesistRNA and rRNA base modificationNOL1/NOP2/sun family putative RNA methylase (TIGR00446; EC 2.1.1.-; HMM-score: 151.1)
    Genetic information processingTranscriptionTranscription factorstranscription antitermination factor NusB (TIGR01951; HMM-score: 57.4)
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationprotein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific (TIGR03533; EC 2.1.1.-; HMM-score: 26)
    Genetic information processingProtein fateProtein modification and repairmethyltransferase, HemK family (TIGR00536; HMM-score: 19.4)
    Genetic information processingProtein fateProtein modification and repairprotein-(glutamine-N5) methyltransferase, release factor-specific (TIGR03534; EC 2.1.1.-; HMM-score: 19.1)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalaminprecorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit (TIGR02469; EC 2.1.1.132; HMM-score: 18.2)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMenaquinone and ubiquinonedemethylmenaquinone methyltransferase (TIGR02752; EC 2.1.1.163; HMM-score: 17.9)
    Genetic information processingProtein synthesistRNA and rRNA base modificationN2,N2-dimethylguanosine tRNA methyltransferase (TIGR00308; EC 2.1.1.-; HMM-score: 17.6)
    Genetic information processingProtein fateProtein modification and repairprotein-L-isoaspartate O-methyltransferase (TIGR00080; EC 2.1.1.77; HMM-score: 14.1)
    Signal transductionRegulatory functionsDNA interactionsbiotin operon repressor (TIGR00122; HMM-score: 13.4)
    Genetic information processingProtein synthesistRNA and rRNA base modificationribosomal RNA large subunit methyltransferase J (TIGR00438; EC 2.1.1.166; HMM-score: 13.1)
    methyltransferase, FxLD system (TIGR04364; HMM-score: 11.2)
  • TheSEED:
  • PFAM:
    NADP_Rossmann (CL0063) Methyltr_RsmB-F; 16S rRNA methyltransferase RsmB/F (PF01189; HMM-score: 174.2)
    NusB (CL0633) NusB; NusB family (PF01029; HMM-score: 108.2)
    NADP_Rossmann (CL0063) Methyltransf_31; Methyltransferase domain (PF13847; HMM-score: 34.3)
    FtsJ; FtsJ-like methyltransferase (PF01728; HMM-score: 18.1)
    Methyltransf_4; Putative methyltransferase (PF02390; HMM-score: 15.5)
    DUF2431; Domain of unknown function (DUF2431) (PF10354; HMM-score: 14.3)
    Ubiquitin (CL0072) NLE; NLE (NUC135) domain (PF08154; HMM-score: 14)
    NADP_Rossmann (CL0063) DUF938; Protein of unknown function (DUF938) (PF06080; HMM-score: 13.9)
    Ubie_methyltran; ubiE/COQ5 methyltransferase family (PF01209; HMM-score: 13.1)
    TRM; N2,N2-dimethylguanosine tRNA methyltransferase (PF02005; HMM-score: 12.9)
    P-loop_NTPase (CL0023) AAA_31; AAA domain (PF13614; HMM-score: 12.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    NWMN_RS03640LysR family transcriptional regulator  [1] (data from MRSA252)
    NWMN_RS04915NAD(+) kinase  [1] (data from MRSA252)
    NWMN_RS05380pyruvate dehydrogenase E1 component subunit alpha  [1] (data from MRSA252)
    NWMN_RS05385pyruvate dehydrogenase E1 component subunit beta  [1] (data from MRSA252)
    NWMN_RS05390dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex  [1] (data from MRSA252)
    NWMN_RS05395dihydrolipoyl dehydrogenase  [1] (data from MRSA252)
    NWMN_RS07455dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex  [1] (data from MRSA252)
    NWMN_RS08865aldehyde dehydrogenase  [1] (data from MRSA252)
    NWMN_RS08905isocitrate dehydrogenase (NADP(+))  [1] (data from MRSA252)
    NWMN_RS08930pyruvate kinase  [1] (data from MRSA252)
    NWMN_RS1230530S ribosomal protein S13  [1] (data from MRSA252)
    NWMN_RS1239530S ribosomal protein S3  [1] (data from MRSA252)
    NWMN_RS14010pyruvate oxidase  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.109
    • Ymax_pos: 22
    • Cmax: 0.126
    • Cmax_pos: 22
    • Smax: 0.143
    • Smax_pos: 18
    • Smean: 0.083
    • D: 0.099
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446494381 NCBI
  • RefSeq: WP_000572235 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MIENVRSLAFDTIQDILNEGAYSNLRINEVLSENELNAMDKALFTEIVYGTVKRKYTLDFYLKPFVKTKIKAWVRQLLWMSIYQYVYLDKVPNHAIINEAVEIAKERGGYHNGNVVNGILRTMMRSDLPDFNEIADPKKRMAIEYSMPKWIIDHWATHYGLEETETILQSFLETTSTTVRANLTRASLDDIIEKLQDEGYDVEKDHDLPYCLHIGGQPIIHSRSFKDGFVSIQDKSSMFVAHIMNVDRHDHVLDACSAPGGKACHIAEVLMPEGQVDASDIHDHKIDLINFNIKKLRLTNIKAFQHDATKPYDKTYDKILVDAPCSGLGVMRHKPEIKYTQSKQHIESLVELQLEILENVKNNVKIGGEIIYSTCTIEQLENENVIYTFLKNNKNFEFEPFQHPITGELVKTLQIMPQDFNSDGFFITKIKRKDN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS06365 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]