From AureoWiki
Jump to: navigation, search

NCBI: 02-MAR-2017

⊟Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS14960 [old locus tag: NWMN_2613 ]
  • pan locus tag?: SAUPAN006490000
  • symbol: NWMN_RS14960
  • pan gene symbol?: rnpA
  • synonym:
  • product: ribonuclease P protein component

⊟Genome View[edit source | edit]

⊟Gene[edit source | edit]

⊟General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS14960 [old locus tag: NWMN_2613 ]
  • symbol: NWMN_RS14960
  • product: ribonuclease P protein component
  • replicon: chromosome
  • strand: -
  • coordinates: 2878072..2878425
  • length: 354
  • essential: unknown

⊟Accession numbers[edit source | edit]

  • Location: NC_009641 (2878072..2878425) NCBI
  • BioCyc:
  • MicrobesOnline:

⊟Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    ATGTTATTGGAAAAAGCTTACCGAATTAAAAAGAATGCAGATTTTCAGAGAATATATAAA
    AAAGGTCATTCTGTAGCCAACAGACAATTTGTTGTATACACTTGTAATAATAAAGAAATA
    GACCATTTTCGCTTAGGTATTAGTGTTTCTAAAAAACTAGGTAATGCAGTGTTAAGAAAC
    AAGATTAAAAGAGCAATACGTGAAAATTTCAAAGTACATAAGTCGCATATATTGGCCAAA
    GATATTATTGTAATAGCAAGACAGCCAGCTAAAGATATGACGACTTTACAAATACAGAAT
    AGTCTTGAGCACGTACTTAAAATTGCCAAAGTTTTTAATAAAAAGATTAAGTAA
    60
    120
    180
    240
    300
    354

⊟Protein[edit source | edit]

⊟General[edit source | edit]

  • locus tag: NWMN_RS14960 [old locus tag: NWMN_2613 ]
  • symbol: NWMN_RS14960
  • description: ribonuclease P protein component
  • length: 117
  • theoretical pI: 11.225
  • theoretical MW: 13652.2
  • GRAVY: -0.417949

⊟Function[edit source | edit]

  • reaction:
    EC 3.1.26.5?  ExPASy
    Ribonuclease PEndonucleolytic cleavage of RNA, removing 5'-extranucleotides from tRNA precursor
  • TIGRFAM:
    Genetic information processingTranscriptionRNA processingribonuclease P protein component (TIGR00188; EC 3.1.26.5; HMM-score: 91.6)
    and 1 more
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidespolysaccharide deacetylase family protein, PEP-CTERM locus subfamily (TIGR03006; HMM-score: 12.2)
  • TheSEED:
  • PFAM:
    S5 (CL0329) Ribonuclease_P; Ribonuclease P (PF00825; HMM-score: 105.1)
    and 1 more
    no clan definedATP-cone; ATP cone domain (PF03477; HMM-score: 15.2)

⊟Structure, modifications & interactions[edit source | edit]

⊟Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.132
    • Ymax_pos: 12
    • Cmax: 0.102
    • Cmax_pos: 29
    • Smax: 0.239
    • Smax_pos: 6
    • Smean: 0.175
    • D: 0.149
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit source | edit]

  • GI:
  • RefSeq: WP_001789343 NCBI
  • UniProt:

⊟Protein sequence[edit source | edit]

  • MLLEKAYRIKKNADFQRIYKKGHSVANRQFVVYTCNNKEIDHFRLGISVSKKLGNAVLRNKIKRAIRENFKVHKSHILAKDIIVIARQPAKDMTTLQIQNSLEHVLKIAKVFNKKIK

⊟Experimental data[edit source | edit]

  • experimentally validated: no data available

⊟Expression & Regulation[edit source | edit]

⊟Operon[edit source | edit]

  • NWMN_RS14960 no polycistronic organisation predicted

⊟Regulation[edit source | edit]

  • sigma factor:
  • regulator:

⊟Transcription pattern[edit source | edit]

⊟Protein synthesis (provided by Aureolib)[edit source | edit]

⊟Protein stability[edit source | edit]

  • half-life: no data available

⊟Biological Material[edit source | edit]

⊟Mutants[edit source | edit]

⊟Expression vector[edit source | edit]

⊟lacZ fusion[edit source | edit]

⊟GFP fusion[edit source | edit]

⊟two-hybrid system[edit source | edit]

⊟FLAG-tag construct[edit source | edit]

⊟Antibody[edit source | edit]

⊟Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

⊟Literature[edit source | edit]

⊟References[edit source | edit]

  1. ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit source | edit]

Retrieved from "https://aureowiki.med.uni-greifswald.de/index.php?title=NWMN_RS14960&oldid=88658"