Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS11740 [old locus tag: SACOL2231 ]
  • pan locus tag?: SAUPAN005694000
  • symbol: SACOL_RS11740
  • pan gene symbol?: rpmC
  • synonym:
  • product: 50S ribosomal protein L29

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS11740 [old locus tag: SACOL2231 ]
  • symbol: SACOL_RS11740
  • product: 50S ribosomal protein L29
  • replicon: chromosome
  • strand: -
  • coordinates: 2302657..2302866
  • length: 210
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (2302657..2302866) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    ATGAAAGCTAAGGAAATTAGAGACTTAACCACTTCAGAAATCGAAGAACAAATCAAATCT
    TCAAAAGAAGAGCTTTTTAACCTACGCTTTCAGTTAGCTACAGGTCAATTAGAAGAAACT
    GCACGTATTCGTACAGTAAGAAAAACGATTGCACGTCTAAAAACTGTTGCTCGTGAAAGA
    GAAATTGAACAAAGTAAGGCTAATCAATAA
    60
    120
    180
    210

Protein[edit source | edit]

Protein Data Bank: 5LI0
Protein Data Bank: 4WCE
Protein Data Bank: 4WFB
Protein Data Bank: 4WF9
Protein Data Bank: 4WFA
Protein Data Bank: 5HL7

General[edit source | edit]

  • locus tag: SACOL_RS11740 [old locus tag: SACOL2231 ]
  • symbol: SACOL_RS11740
  • description: 50S ribosomal protein L29
  • length: 69
  • theoretical pI: 10.3881
  • theoretical MW: 8090.19
  • GRAVY: -0.895652

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal protein uL29 (TIGR00012; HMM-score: 76.9)
  • TheSEED:
  • PFAM:
    Ribo_L29 (CL0346) Ribosomal_L29; Ribosomal L29 protein (PF00831; HMM-score: 85)
    no clan definedDnaG_DnaB_bind; DNA primase DnaG DnaB-binding (PF08278; HMM-score: 13.9)

Structure, modifications & interactions[edit source | edit]

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.102
    • Ymax_pos: 68
    • Cmax: 0.106
    • Cmax_pos: 4
    • Smax: 0.116
    • Smax_pos: 67
    • Smean: 0.081
    • D: 0.094
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446567391 NCBI
  • RefSeq: WP_000644737 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKAKEIRDLTTSEIEEQIKSSKEELFNLRFQLATGQLEETARIRTVRKTIARLKTVAREREIEQSKANQ

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS11740 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 1.45 1.46 1.47 1.48 1.49 1.50 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]