From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000976000
  • symbol?: capC
  • description?: capsular polysaccharide synthesis protein Cap8C

      descriptions from strain specific annotations:

    • capsular polysaccharide synthesis protein Cap8C
    • protein-tyrosine-phosphatase
    • Capsular polysaccharide synthesis enzyme Cap5C
    • Manganese-dependent protein-tyrosine phosphatase
    • putative tyrosine-protein phosphatase capC
    • capsular polysaccharide synthesis enzyme Cap8C
    • capsular polysaccharide biosynthesis protein Cap5C
    • capsular polysaccharide biosynthesis protein Cap8C
    • capsular polysaccharide synthesis enzyme CapC
    • capsular polysaccharide biosynthesis protein CapC
    • PHP domain-containing protein
    • phosphotyrosine-protein phosphatase (capsular polysaccharide biosynthesis)
  • strand?: +
  • coordinates?: 1231996..1232760
  • synteny block?: BlockID0005100
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0138 (cap5C)
    N315:
    SA0146 (capC)
    NCTC8325:
    Newman:
    NWMN_0097 (capC)
    USA300_FPR3757:
    SAUSA300_0154 (cap5C)
    04-02981:
    SA2981_0152 (capC)
    08BA02176:
    C248_0140 (capC)
    11819-97:
    MS7_0145
    71193:
    ST398NM01_0165
    ECT-R 2:
    ECTR2_108
    ED133:
    SAOV_0098
    ED98:
    SAAV_0119 (cap5C)
    HO 5096 0412:
    SAEMRSA15_01170 (capC)
    JH1:
    SaurJH1_0142
    JH9:
    SaurJH9_0137
    JKD6008:
    SAA6008_00129 (cap5C)
    JKD6159:
    SAA6159_00135 (cap5C)
    LGA251:
    SARLGA251_01250 (capC)
    M013:
    M013TW_0141
    MRSA252:
    SAR0153 (capC)
    MSHR1132:
    SAMSHR1132_01250
    MSSA476:
    SAS0126
    Mu3:
    SAHV_0150 (capC)
    Mu50:
    SAV0151 (capC)
    MW2:
    MW0126 (cap8C)
    RF122:
    SAB0092 (capC)
    ST398:
    SAPIG0165
    T0131:
    SAT0131_00141
    TCH60:
    HMPREF0772_10347 (epsC)
    TW20:
    SATW20_01620 (capC)
    USA300_TCH1516:
    USA300HOU_0165 (cap5C)
    VC40:
    SAVC_00525

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIDIHNHILPNIDDGPTNETEMMDLLKQATTQGVTEIIVTSHHLHPRYTTPIEKVKSCLN
    N315            MIDIHNHILPNIDDGPTNETEMMDLLKQATTQGVTEIIVTSHHLHPRYTTPIEKVKSCLN
    NCTC8325        MIDIHNHILPNIDDGPTNETEMMDLLKQATTQGVTEIIVTSHHLHPRYTTPIEKVKSCLN
    Newman          MIDIHNHILPNIDDGPTNETEMMDLLKQATTQGVTEIIVTSHHLHPRYTTPIEKVKSCLN
    USA300_FPR3757  MIDIHNHILPNIDDGPTNETEMMDLLKQATTQGVTEIIVTSHHLHPRYTTPIEKVKSCLN
                    ************************************************************

    COL             HIESLEEVQALNLKFYYGQEIRITDQILNDIDRKVINGINDSRYLLIEFPSNEVPHYTDQ
    N315            HIESLEEVQALNLKFYYGQEIRITDQILNDIDRKVITGINDSRYLLIEFPSNEVPHYTDQ
    NCTC8325        HIESLEEVQALNLKFYYGQEIRITDQILNDIDRKVINGINDSRYLLIEFPSNEVPHYTDQ
    Newman          HIESLEEVQALNLKFYYGQEIRITDQILNDIDRKVINGINDSRYLLIEFPSNEVPHYTDQ
    USA300_FPR3757  HIESLEEVQALNLKFYYGQEIRITDQILNDIDRKVINGINDSRYLLIEFPSNEVPHYTDQ
                    ************************************.***********************

    COL             LFFELQSKGFVPIIAHPERNKAISQNLDILYDLINKGALSQVTTASLAGISGKKIRKLAI
    N315            LFFELQSKGFVPIIAHPERNKAISQNLDILYDLINKGALSQVTTASLAGISGKKIRKLAI
    NCTC8325        LFFELQSKGFVPIIAHPERNKAISQNLDILYDLINKGALSQVTTASLAGISGKKIRKLAI
    Newman          LFFELQSKGFVPIIAHPERNKAISQNLDILYDLINKGALSQVTTASLAGISGKKIRKLAI
    USA300_FPR3757  LFFELQSKGFVPIIAHPERNKAISQNLDILYDLINKGALSQVTTASLAGISGKKIRKLAI
                    ************************************************************

    COL             QMIENNLTHFIGSDAHNTEIRPFLMKDLFNDKKLRDYYEDMNGFISNAKLVVDDKKIPKR
    N315            QMIENNLTHFIGSDAHNTEIRPFLMKDLFNDKKLRDYYEDMNGFISNAKLVVDDKKIPKR
    NCTC8325        QMIENNLTHFIGSDAHNTEIRPFLMKDLFNDKKLRDYYEDMNGFISNAKLVVDDKKIPKR
    Newman          QMIENNLTHFIGSDAHNTEIRPFLMKDLFNDKKLRDYYEDMNGFISNAKLVVDDKKIPKR
    USA300_FPR3757  QMIENNLTHFIGSDAHNTEIRPFLMKDLFNDKKLRDYYEDMNGFISNAKLVVDDKKIPKR
                    ************************************************************

    COL             MPQQDYKQKRWFGL
    N315            MPQQDYKQKRWFGL
    NCTC8325        MPQQDYKQKRWFGL
    Newman          MPQQDYKQKRWFGL
    USA300_FPR3757  MPQQDYKQKRWFGL
                    **************