From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003195000
  • symbol?: ugtP
  • description?: diacylglycerol glucosyltransferase

      descriptions from strain specific annotations:

    • diacylglycerol glucosyltransferase
    • diacylglycerol beta-glucosyltransferase
    • diglucosyldiacylglycerol synthase (LTA membrane anchor synthesis)
    • processive diacylglycerol glucosyltransferase
    • 1,2-diacylglycerol 3-glucosyltransferase
    • monogalactosyldiacylglycerol (MGDG) synthase family protein
    • processive diacylglycerol glucosyltransferase YpfP
    • UDP-glucose diacylglycerol glucosyltransferase
  • strand?: -
  • coordinates?: 3586499..3587674
  • synteny block?: BlockID0022820
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1022 (ypfP)
    N315:
    NCTC8325:
    Newman:
    NWMN_0887 (murG)
    USA300_FPR3757:
    04-02981:
    SA2981_0971
    08BA02176:
    C248_1041
    11819-97:
    MS7_0973 (ugtP)
    71193:
    ST398NM01_1013
    ECT-R 2:
    ECTR2_872
    ED133:
    SAOV_0962c
    ED98:
    SAAV_0979 (ypfP)
    HO 5096 0412:
    SAEMRSA15_08470
    JH1:
    SaurJH1_1034
    JH9:
    SaurJH9_1015
    JKD6008:
    SAA6008_00972 (ypfP)
    JKD6159:
    SAA6159_00873 (ypfP)
    LGA251:
    SARLGA251_09320 (ugtP)
    M013:
    M013TW_0942
    MRSA252:
    SAR0987
    MSHR1132:
    SAMSHR1132_08640
    MSSA476:
    SAS0886
    Mu3:
    SAHV_1011
    Mu50:
    SAV1017
    MW2:
    MW0898
    RF122:
    SAB0883c
    ST398:
    SAPIG1013
    T0131:
    SAT0131_01052
    TCH60:
    HMPREF0772_12217 (ypfP)
    TW20:
    SATW20_10140 (ugtP)
    USA300_TCH1516:
    USA300HOU_0975
    VC40:
    SAVC_04250

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVTQNKKILIITGSFGNGHMQVTQSIVNQLNDMNLDHLSVIEHDLFMEAHPILTSICKKW
    N315            MVTQNKKILIITGSFGNGHMQVTQSIVNQLNDMNLDHLSVIEHDLFMEAHPILTSICKKW
    NCTC8325        MVTQNKKILIITGSFGNGHMQVTQSIVNQLNDMNLDHLSVIEHDLFMEAHPILTSICKKW
    Newman          MVTQNKKILIITGSFGNGHMQVTQSIVNQLNDMNLDHLSVIEHDLFMEAHPILTSICKKW
    USA300_FPR3757  MVTQNKKILIITGSFGNGHMQVTQSIVNQLNDMNLDHLSVIEHDLFMEAHPILTSICKKW
                    ************************************************************

    COL             YINSFKYFRNMYKGFYYSRPDKLDKCFYKYYGLNKLINLLIKEKPDLILLTFPTPVMSVL
    N315            YINSFKYFRNMYKGFYYSRPDKLDKCFYKYYGLNKLINLLIKEKPDLILLTFPTPVMSVL
    NCTC8325        YINSFKYFRNMYKGFYYSRPDKLDKCFYKYYGLNKLINLLIKEKPDLILLTFPTPVMSVL
    Newman          YINSFKYFRNMYKGFYYSRPDKLDKCFYKYYGLNKLINLLIKEKPDLILLTFPTPVMSVL
    USA300_FPR3757  YINSFKYFRNMYKGFYYSRPDKLDKCFYKYYGLNKLINLLIKEKPDLILLTFPTPVMSVL
                    ************************************************************

    COL             TEQFNINIPVATVMTDYRLHKNWITPYSTRYYVATKETKQDFIDVGIDPSTVKVTGIPID
    N315            TEQFNINIPVATVMTDYRLHKNWITPYSTRYYVATKETKQDFIDVGIDPSTVKVTGIPID
    NCTC8325        TEQFNINIPVATVMTDYRLHKNWITPYSTRYYVATKETKQDFIDVGIDPSTVKVTGIPID
    Newman          TEQFNINIPVATVMTDYRLHKNWITPYSTRYYVATKETKQDFIDVGIDPSTVKVTGIPID
    USA300_FPR3757  TEQFNINIPVATVMTDYRLHKNWITPYSTRYYVATKETKQDFIDVGIDPSTVKVTGIPID
                    ************************************************************

    COL             NKFETPINQKQWLIDNNLDPDKQTILMSAGAFGVSKGFDTMITDILAKSANAQVVMICGK
    N315            NKFETPINQKQWLIDNNLDPDKQTILMSAGAFGVSKGFDTMITDILAKSANAQVVMICGK
    NCTC8325        NKFETPINQKQWLIDNNLDPDKQTILMSAGAFGVSKGFDTMITDILAKSANAQVVMICGK
    Newman          NKFETPINQKQWLIDNNLDPDKQTILMSAGAFGVSKGFDTMITDILAKSANAQVVMICGK
    USA300_FPR3757  NKFETPINQKQWLIDNNLDPDKQTILMSAGAFGVSKGFDTMITDILAKSANAQVVMICGK
                    ************************************************************

    COL             SKELKRSLTAKFKSNENVLILGYTKHMNEWMASSQLMITKPGGITITEGFARCIPMIFLN
    N315            SKELKRSLIAKFKSNENVLILGYTKHMNEWMASSQLMITKPGGITITEGFARCIPMIFLN
    NCTC8325        SKELKRSLTAKFKSNENVLILGYTKHMNEWMASSQLMITKPGGITITEGFARCIPMIFLN
    Newman          SKELKRSLTAKFKSNENVLILGYTKHMNEWMASSQLMITKPGGITITEGFARCIPMIFLN
    USA300_FPR3757  SKELKRSLTAKFKSNENVLILGYTKHMNEWMASSQLMITKPGGITITEGFARCIPMIFLN
                    ******** ***************************************************

    COL             PAPGQELENALYFEEKGFGKIADTPEEAIKIVASLTNGNEQLTNMISTMEQDKIKYATQT
    N315            PAPGQELENALYFEEKGFGKIADTPEEAIKIVASLTNGNEQLTNMISTMEQDKIKYATQT
    NCTC8325        PAPGQELENALYFEEKGFGKIADTPEEAIKIVASLTNGNEQLTNMISTMEQDKIKYATQT
    Newman          PAPGQELENALYFEEKGFGKIADTPEEAIKIVASLTNGNEQLTNMISTMEQDKIKYATQT
    USA300_FPR3757  PAPGQELENALYFEEKGFGKIADTPEEAIKIVASLTNGNEQLTNMISTMEQDKIKYATQT
                    ************************************************************

    COL             ICRDLLDLIGHSSQPQEIYGKVPLYARFFVK
    N315            ICRDLLDLIGHSSQPQEIYGKVPLYARFFVK
    NCTC8325        ICRDLLDLIGHSSQPQEIYGKVPLYARFFVK
    Newman          ICRDLLDLIGHSSQPQEIYGKVPLYARFFVK
    USA300_FPR3757  ICRDLLDLIGHSSQPQEIYGKVPLYARFFVK
                    *******************************