Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA1656 [new locus tag: SA_RS09360 ]
- pan locus tag?: SAUPAN004763000
- symbol: hit
- pan gene symbol?: hit
- synonym:
- product: cell-cycle regulation Hit-like protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA1656 [new locus tag: SA_RS09360 ]
- symbol: hit
- product: cell-cycle regulation Hit-like protein
- replicon: chromosome
- strand: +
- coordinates: 1890292..1890714
- length: 423
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1124507 NCBI
- RefSeq: NP_374945 NCBI
- BioCyc: see SA_RS09360
- MicrobesOnline: 103971 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGTCAGAAACAATTTTCGGCAAAATTTTAACTGGAGAAATTCCTAGCTTTAAAGTATAT
GAAGACGATTATGTCTATGCCTTTTTAGATATATCACAAGTTACTAAAGGACATACGTTA
TTAATTCCTAAAAAAGCTTCTGCTAATATCTTTGAAACTGATGAAGAAACAATGAAACAT
ATCGGTGCAGCATTACCTAAAGTAGCAAATGCTATTAAGCGTGCATTTAATCCTGATGGT
TTAAACATTATTCAAAATAATGGTGAGTTTGCAGATCAATCTGTATTTCATATTCATTTC
CACTTAATTCCTCGATACGAAAATGATATTGATGGATTTGGTTATAAGTGGGAAACACAT
GAAGACATTTTAGATAACGATGCAAAACAACAAATTGCTGAACAAATTCAAGCACAATTT
TAA60
120
180
240
300
360
420
423
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA1656 [new locus tag: SA_RS09360 ]
- symbol: Hit
- description: cell-cycle regulation Hit-like protein
- length: 140
- theoretical pI: 4.65977
- theoretical MW: 15944.8
- GRAVY: -0.363571
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- Histidine triad (HIT) nucleotide-binding protein, similarity with At5g48545 and yeast YDL125C (HNT1)
- PFAM: HIT (CL0265) HIT; HIT domain (PF01230; HMM-score: 95.9)and 2 moreDcpS_C; Scavenger mRNA decapping enzyme C-term binding (PF11969; HMM-score: 42.7)CwfJ_C_1; Protein similar to CwfJ C-terminus 1 (PF04677; HMM-score: 12.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9946
- Cytoplasmic Membrane Score: 0.001
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0043
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002902
- TAT(Tat/SPI): 0.000496
- LIPO(Sec/SPII): 0.000222
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSETIFGKILTGEIPSFKVYEDDYVYAFLDISQVTKGHTLLIPKKASANIFETDEETMKHIGAALPKVANAIKRAFNPDGLNIIQNNGEFADQSVFHIHFHLIPRYENDIDGFGYKWETHEDILDNDAKQQIAEQIQAQF
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
SA0033 (aadD) kanamycin nucleotidyltransferase [1] (data from MRSA252) SA1075 (acpP) acyl carrier protein [1] (data from MRSA252) SA1984 (asp23) alkaline shock protein 23 [1] (data from MRSA252) SA0471 (cysK) hypothetical protein [1] (data from MRSA252) SA1409 (dnaK) molecular chaperone DnaK [1] (data from MRSA252) SA1941 (dps) general stress protein 20U [1] (data from MRSA252) SA1102 (frr) ribosome recycling factor [1] (data from MRSA252) SA0505 (fus) elongation factor G [1] (data from MRSA252) SA1716 (gatA) aspartyl/glutamyl-tRNA amidotransferase subunit A [1] (data from MRSA252) SA1715 (gatB) aspartyl/glutamyl-tRNA amidotransferase subunit B [1] (data from MRSA252) SA1150 (glnA) glutamine-ammonia ligase [1] (data from MRSA252) SA1305 (hu) DNA-binding protein II [1] (data from MRSA252) SA1244 (odhB) dihydrolipoamide succinyltransferase [1] (data from MRSA252) SA0943-1 (pdhA) pyruvate dehydrogenase E1 component subunit alpha [1] (data from MRSA252) SA0944 (pdhB) pyruvate dehydrogenase E1 component subunit beta [1] (data from MRSA252) SA0945 (pdhC) branched-chain alpha-keto acid dehydrogenase E2 subunit [1] (data from MRSA252) SA0946 (pdhD) dihydrolipoamide dehydrogenase [1] (data from MRSA252) SA0934 (ptsH) phosphocarrier protein HPr [1] (data from MRSA252) SA0935 (ptsI) phosphoenolpyruvate-protein phosphatase [1] (data from MRSA252) SA1520 (pykA) pyruvate kinase [1] (data from MRSA252) SA2044 (rplB) 50S ribosomal protein L2 [1] (data from MRSA252) SA2047 (rplC) 50S ribosomal protein L3 [1] (data from MRSA252) SA2046 (rplD) 50S ribosomal protein L4 [1] (data from MRSA252) SA2033 (rplF) 50S ribosomal protein L6 [1] (data from MRSA252) SA0497 (rplJ) 50S ribosomal protein L10 [1] (data from MRSA252) SA2029 (rplO) 50S ribosomal protein L15 [1] (data from MRSA252) SA2040 (rplP) 50S ribosomal protein L16 [1] (data from MRSA252) SA2032 (rplR) 50S ribosomal protein L18 [1] (data from MRSA252) SA1084 (rplS) 50S ribosomal protein L19 [1] (data from MRSA252) SA1473 (rplU) 50S ribosomal protein L21 [1] (data from MRSA252) SA2042 (rplV) 50S ribosomal protein L22 [1] (data from MRSA252) SA2041 (rpsC) 30S ribosomal protein S3 [1] (data from MRSA252) SA2031 (rpsE) 30S ribosomal protein S5 [1] (data from MRSA252) SA0352 (rpsF) 30S ribosomal protein S6 [1] (data from MRSA252) SA2034 (rpsH) 30S ribosomal protein S8 [1] (data from MRSA252) SA2024 (rpsK) 30S ribosomal protein S11 [1] (data from MRSA252) SA1116 (rpsO) 30S ribosomal protein S15 [1] (data from MRSA252) SA2038 (rpsQ) 30S ribosomal protein S17 [1] (data from MRSA252) SA2043 (rpsS) 30S ribosomal protein S19 [1] (data from MRSA252) SA1414 (rpsT) 30S ribosomal protein S20 [1] (data from MRSA252) SA0107 (spa) immunoglobulin G binding protein A [1] (data from MRSA252) SA1245 (sucA) 2-oxoglutarate dehydrogenase E1 [1] (data from MRSA252) SA1088 (sucC) succinyl-CoA synthetase subunit beta [1] (data from MRSA252) SA1499 (tig) trigger factor [1] (data from MRSA252) SA1177 (tkt) transketolase [1] (data from MRSA252) SA1535 (tpx) thiol peroxidase [1] (data from MRSA252) SA0992 (trxA) thioredoxin [1] (data from MRSA252) SA0506 (tuf) elongation factor Tu [1] (data from MRSA252) SA0295 hypothetical protein [1] (data from MRSA252) SA0528 hypothetical protein [1] (data from MRSA252) SA0627 hypothetical protein [1] (data from MRSA252) SA0802 hypothetical protein [1] (data from MRSA252) SA0873 hypothetical protein [1] (data from MRSA252) SA1528 hypothetical protein [1] (data from MRSA252) SA1532 hypothetical protein [1] (data from MRSA252) SA1663 hypothetical protein [1] (data from MRSA252) SA2399 fructose-1,6-bisphosphate aldolase [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 1.45 1.46 1.47 1.48 1.49 1.50 1.51 1.52 1.53 1.54 1.55 1.56 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)