Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1355 [new locus tag: SACOL_RS06900 ]
- pan locus tag?: SAUPAN003690000
- symbol: SACOL1355
- pan gene symbol?: —
- synonym:
- product: LuxR family DNA-binding response regulator
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1355 [new locus tag: SACOL_RS06900 ]
- symbol: SACOL1355
- product: LuxR family DNA-binding response regulator
- replicon: chromosome
- strand: +
- coordinates: 1362088..1362690
- length: 603
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237166 NCBI
- RefSeq: YP_186208 NCBI
- BioCyc:
- MicrobesOnline: 912814 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601ATGACATCTTTAATTATTGCAGAAGATCAAAATATGTTACGACAGGCAATGGTTCAATTA
ATTAAACTACATGGTGATTTTGAAATTTTAGCAGATACTGATAATGGTCTCGATGCAATG
AAACTTATTGAAGAATATAATCCTAACGTTGTTATTTTAGATATAGAAATGCCAGGCATG
ACTGGACTTGAAGTTTTAGCGGAAATTAGAAAAAAGCATTTGAATATTAAAGTGATTATT
GTAACAACTTTTAAAAGACCGGGATACTTTGAAAAAGCAGTTGTGAATGATGTGGATGCA
TATGTTTTAAAAGAACGTTCTATAGAAGAATTGGTGGAAACCATTAATAAAGTAAATAAC
GGAGAGAAAGAATATAGCGCCACATTGATGACTTCATTTTTTGTAGATAAAAACCCATTA
ACGCCCAAAGAACAAATTGTATTAAGGGAAATTGGCAATGGTTTAAGTAGTAAAGAAATA
AGTGAAAAATTATTTTTGACAGATGGAACAGTTAGAAATTATACATCTGTTATAATTGAT
AAATTATTTGCAGATAATCGTTTTGATGCTTGGAAAAAGGCAAATGAAAAAGGCTGGATC
TAA60
120
180
240
300
360
420
480
540
600
603
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1355 [new locus tag: SACOL_RS06900 ]
- symbol: SACOL1355
- description: LuxR family DNA-binding response regulator
- length: 200
- theoretical pI: 4.76163
- theoretical MW: 22783.2
- GRAVY: -0.17
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Sporulation and germination sporulation transcription factor Spo0A (TIGR02875; HMM-score: 61.7)and 10 moreCentral intermediary metabolism Nitrogen metabolism nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 40.7)Regulatory functions DNA interactions nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 40.7)Signal transduction Two-component systems nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 40.7)Regulatory functions DNA interactions phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 37.2)Signal transduction Two-component systems phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 37.2)Regulatory functions DNA interactions heavy metal response regulator (TIGR01387; HMM-score: 34.8)transcriptional regulator EpsA (TIGR03020; HMM-score: 21.7)Regulatory functions DNA interactions PEP-CTERM-box response regulator transcription factor (TIGR02915; HMM-score: 18.1)Signal transduction Two-component systems TMAO reductase sytem sensor TorS (TIGR02956; EC 2.7.13.3; HMM-score: 16.1)RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 14.7)
- TheSEED: Two-component transcriptional response regulator, LuxR family
- PFAM: CheY (CL0304) Response_reg; Response regulator receiver domain (PF00072; HMM-score: 87)and 5 moreHTH (CL0123) GerE; Bacterial regulatory proteins, luxR family (PF00196; HMM-score: 44.9)Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 18.3)Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 14)no clan defined Gp44; Mycobacterium phage hypothetical protein Gp44.1 (PF17510; HMM-score: 13.5)HTH (CL0123) HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 12.6)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- protein partners:
SACOL1760 (ackA) acetate kinase [1] (data from MRSA252) SACOL2657 (arcA) arginine deiminase [1] (data from MRSA252) SACOL1637 (dnaK) molecular chaperone DnaK [1] (data from MRSA252) SACOL0002 (dnaN) DNA polymerase III subunit beta [1] (data from MRSA252) SACOL0842 (eno) phosphopyruvate hydratase [1] (data from MRSA252) SACOL1016 (fabI) enoyl-ACP reductase [1] (data from MRSA252) SACOL1782 (fhs) formate--tetrahydrofolate ligase [1] (data from MRSA252) SACOL1199 (ftsZ) cell division protein FtsZ [1] (data from MRSA252) SACOL0593 (fusA) elongation factor G [1] (data from MRSA252) SACOL1734 (gapA2) glyceraldehyde 3-phosphate dehydrogenase 2 [1] (data from MRSA252) SACOL1961 (gatA) aspartyl/glutamyl-tRNA amidotransferase subunit A [1] (data from MRSA252) SACOL2016 (groEL) chaperonin GroEL [1] (data from MRSA252) SACOL1513 (hup) DNA-binding protein HU [1] (data from MRSA252) SACOL1741 (icd) isocitrate dehydrogenase [1] (data from MRSA252) SACOL1477 (ilvA1) threonine dehydratase [1] (data from MRSA252) SACOL1288 (infB) translation initiation factor IF-2 [1] (data from MRSA252) SACOL0222 (ldh1) L-lactate dehydrogenase [1] (data from MRSA252) SACOL2623 (mqo2) malate:quinone oxidoreductase [1] (data from MRSA252) SACOL2116 (murAB) UDP-N-acetylglucosamine 1-carboxyvinyltransferase [1] (data from MRSA252) SACOL0792 (nrdE) ribonucleotide-diphosphate reductase subunit alpha [1] (data from MRSA252) SACOL1285 (nusA) transcription elongation factor NusA [1] (data from MRSA252) SACOL1102 (pdhA) pyruvate dehydrogenase complex E1 component subunit alpha [1] (data from MRSA252) SACOL1105 (pdhD) dihydrolipoamide dehydrogenase [1] (data from MRSA252) SACOL2128 (pdp) pyrimidine-nucleoside phosphorylase [1] (data from MRSA252) SACOL0204 (pflB) formate acetyltransferase [1] (data from MRSA252) SACOL1745 (pyk) pyruvate kinase [1] (data from MRSA252) SACOL0584 (rplA) 50S ribosomal protein L1 [1] (data from MRSA252) SACOL2236 (rplB) 50S ribosomal protein L2 [1] (data from MRSA252) SACOL2239 (rplC) 50S ribosomal protein L3 [1] (data from MRSA252) SACOL2227 (rplE) 50S ribosomal protein L5 [1] (data from MRSA252) SACOL2224 (rplF) 50S ribosomal protein L6 [1] (data from MRSA252) SACOL0585 (rplJ) 50S ribosomal protein L10 [1] (data from MRSA252) SACOL0583 (rplK) 50S ribosomal protein L11 [1] (data from MRSA252) SACOL0586 (rplL) 50S ribosomal protein L7/L12 [1] (data from MRSA252) SACOL2220 (rplO) 50S ribosomal protein L15 [1] (data from MRSA252) SACOL1257 (rplS) 50S ribosomal protein L19 [1] (data from MRSA252) SACOL1725 (rplT) 50S ribosomal protein L20 [1] (data from MRSA252) SACOL1702 (rplU) 50S ribosomal protein L21 [1] (data from MRSA252) SACOL2234 (rplV) 50S ribosomal protein L22 [1] (data from MRSA252) SACOL2237 (rplW) 50S ribosomal protein L23 [1] (data from MRSA252) SACOL0545 (rplY) 50S ribosomal protein L25/general stress protein Ctc [1] (data from MRSA252) SACOL1700 (rpmA) 50S ribosomal protein L27 [1] (data from MRSA252) SACOL1274 (rpsB) 30S ribosomal protein S2 [1] (data from MRSA252) SACOL2233 (rpsC) 30S ribosomal protein S3 [1] (data from MRSA252) SACOL1769 (rpsD) 30S ribosomal protein S4 [1] (data from MRSA252) SACOL2222 (rpsE) 30S ribosomal protein S5 [1] (data from MRSA252) SACOL0437 (rpsF) 30S ribosomal protein S6 [1] (data from MRSA252) SACOL0592 (rpsG) 30S ribosomal protein S7 [1] (data from MRSA252) SACOL2206 (rpsI) 30S ribosomal protein S9 [1] (data from MRSA252) SACOL2240 (rpsJ) 30S ribosomal protein S10 [1] (data from MRSA252) SACOL2214 (rpsK) 30S ribosomal protein S11 [1] (data from MRSA252) SACOL2215 (rpsM) 30S ribosomal protein S13 [1] (data from MRSA252) SACOL1254 (rpsP) 30S ribosomal protein S16 [1] (data from MRSA252) SACOL2235 (rpsS) 30S ribosomal protein S19 [1] (data from MRSA252) SACOL1448 (sucB) dihydrolipoamide succinyltransferase [1] (data from MRSA252) SACOL1262 (sucC) succinyl-CoA synthetase subunit beta [1] (data from MRSA252) SACOL0626 (thiD1) phosphomethylpyrimidine kinase [1] (data from MRSA252) SACOL0840 (tpiA) triosephosphate isomerase [1] (data from MRSA252) SACOL0594 (tuf) elongation factor Tu [1] (data from MRSA252) SACOL2104 (upp) uracil phosphoribosyltransferase [1] (data from MRSA252) SACOL0564 pyridoxal biosynthesis lyase PdxS [1] (data from MRSA252) SACOL0914 FeS assembly ATPase SufC [1] (data from MRSA252) SACOL0944 NADH dehydrogenase [1] (data from MRSA252) SACOL0973 fumarylacetoacetate hydrolase [1] (data from MRSA252) SACOL1759 universal stress protein [1] (data from MRSA252) SACOL1952 ferritins family protein [1] (data from MRSA252) SACOL2173 alkaline shock protein 23 [1] (data from MRSA252) SACOL2553 pyruvate oxidase [1] (data from MRSA252) SACOL2561 hydroxymethylglutaryl-CoA synthase [1] (data from MRSA252)
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.001525
- TAT(Tat/SPI): 0.000108
- LIPO(Sec/SPII): 0.00018
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTSLIIAEDQNMLRQAMVQLIKLHGDFEILADTDNGLDAMKLIEEYNPNVVILDIEMPGMTGLEVLAEIRKKHLNIKVIIVTTFKRPGYFEKAVVNDVDAYVLKERSIEELVETINKVNNGEKEYSATLMTSFFVDKNPLTPKEQIVLREIGNGLSSKEISEKLFLTDGTVRNYTSVIIDKLFADNRFDAWKKANEKGWI
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 1.45 1.46 1.47 1.48 1.49 1.50 1.51 1.52 1.53 1.54 1.55 1.56 1.57 1.58 1.59 1.60 1.61 1.62 1.63 1.64 1.65 1.66 1.67 1.68
Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p) - ↑
Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑
Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑
Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]