Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1355 [new locus tag: SACOL_RS06900 ]
- pan locus tag?: SAUPAN003690000
- symbol: SACOL1355
- pan gene symbol?: —
- synonym:
- product: LuxR family DNA-binding response regulator
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1355 [new locus tag: SACOL_RS06900 ]
- symbol: SACOL1355
- product: LuxR family DNA-binding response regulator
- replicon: chromosome
- strand: +
- coordinates: 1362088..1362690
- length: 603
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237166 NCBI
- RefSeq: YP_186208 NCBI
- BioCyc: see SACOL_RS06900
- MicrobesOnline: 912814 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601ATGACATCTTTAATTATTGCAGAAGATCAAAATATGTTACGACAGGCAATGGTTCAATTA
ATTAAACTACATGGTGATTTTGAAATTTTAGCAGATACTGATAATGGTCTCGATGCAATG
AAACTTATTGAAGAATATAATCCTAACGTTGTTATTTTAGATATAGAAATGCCAGGCATG
ACTGGACTTGAAGTTTTAGCGGAAATTAGAAAAAAGCATTTGAATATTAAAGTGATTATT
GTAACAACTTTTAAAAGACCGGGATACTTTGAAAAAGCAGTTGTGAATGATGTGGATGCA
TATGTTTTAAAAGAACGTTCTATAGAAGAATTGGTGGAAACCATTAATAAAGTAAATAAC
GGAGAGAAAGAATATAGCGCCACATTGATGACTTCATTTTTTGTAGATAAAAACCCATTA
ACGCCCAAAGAACAAATTGTATTAAGGGAAATTGGCAATGGTTTAAGTAGTAAAGAAATA
AGTGAAAAATTATTTTTGACAGATGGAACAGTTAGAAATTATACATCTGTTATAATTGAT
AAATTATTTGCAGATAATCGTTTTGATGCTTGGAAAAAGGCAAATGAAAAAGGCTGGATC
TAA60
120
180
240
300
360
420
480
540
600
603
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1355 [new locus tag: SACOL_RS06900 ]
- symbol: SACOL1355
- description: LuxR family DNA-binding response regulator
- length: 200
- theoretical pI: 4.76163
- theoretical MW: 22783.2
- GRAVY: -0.17
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Sporulation and germination sporulation transcription factor Spo0A (TIGR02875; HMM-score: 61.7)and 10 moreCentral intermediary metabolism Nitrogen metabolism nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 40.7)Regulatory functions DNA interactions nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 40.7)Signal transduction Two-component systems nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 40.7)Regulatory functions DNA interactions phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 37.2)Signal transduction Two-component systems phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 37.2)Regulatory functions DNA interactions heavy metal response regulator (TIGR01387; HMM-score: 34.8)transcriptional regulator EpsA (TIGR03020; HMM-score: 21.7)Regulatory functions DNA interactions PEP-CTERM-box response regulator transcription factor (TIGR02915; HMM-score: 18.1)Signal transduction Two-component systems TMAO reductase sytem sensor TorS (TIGR02956; EC 2.7.13.3; HMM-score: 16.1)RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 14.7)
- TheSEED :
- Two-component transcriptional response regulator, LuxR family
- PFAM: CheY (CL0304) Response_reg; Response regulator receiver domain (PF00072; HMM-score: 84.3)and 6 moreHTH (CL0123) GerE; Bacterial regulatory proteins, luxR family (PF00196; HMM-score: 45.3)Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 18)Ubiquitin (CL0072) SAP18; Sin3 associated polypeptide p18 (SAP18) (PF06487; HMM-score: 13.9)HTH (CL0123) Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 13.4)no clan defined GP44; Gene product 44 (PF17510; HMM-score: 12.9)HTH (CL0123) HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 12.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9937
- Cytoplasmic Membrane Score: 0.0028
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0034
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.001525
- TAT(Tat/SPI): 0.000108
- LIPO(Sec/SPII): 0.00018
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTSLIIAEDQNMLRQAMVQLIKLHGDFEILADTDNGLDAMKLIEEYNPNVVILDIEMPGMTGLEVLAEIRKKHLNIKVIIVTTFKRPGYFEKAVVNDVDAYVLKERSIEELVETINKVNNGEKEYSATLMTSFFVDKNPLTPKEQIVLREIGNGLSSKEISEKLFLTDGTVRNYTSVIIDKLFADNRFDAWKKANEKGWI
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization: Cytoplasmic [1] [2] [3]
- quantitative data / protein copy number per cell:
- interaction partners:
SACOL1760 (ackA) acetate kinase [4] (data from MRSA252) SACOL2657 (arcA) arginine deiminase [4] (data from MRSA252) SACOL1637 (dnaK) molecular chaperone DnaK [4] (data from MRSA252) SACOL0002 (dnaN) DNA polymerase III subunit beta [4] (data from MRSA252) SACOL0842 (eno) phosphopyruvate hydratase [4] (data from MRSA252) SACOL1016 (fabI) enoyl-ACP reductase [4] (data from MRSA252) SACOL1782 (fhs) formate--tetrahydrofolate ligase [4] (data from MRSA252) SACOL1199 (ftsZ) cell division protein FtsZ [4] (data from MRSA252) SACOL0593 (fusA) elongation factor G [4] (data from MRSA252) SACOL1734 (gapA2) glyceraldehyde 3-phosphate dehydrogenase 2 [4] (data from MRSA252) SACOL1961 (gatA) aspartyl/glutamyl-tRNA amidotransferase subunit A [4] (data from MRSA252) SACOL2016 (groEL) chaperonin GroEL [4] (data from MRSA252) SACOL1513 (hup) DNA-binding protein HU [4] (data from MRSA252) SACOL1741 (icd) isocitrate dehydrogenase [4] (data from MRSA252) SACOL1477 (ilvA1) threonine dehydratase [4] (data from MRSA252) SACOL1288 (infB) translation initiation factor IF-2 [4] (data from MRSA252) SACOL0222 (ldh1) L-lactate dehydrogenase [4] (data from MRSA252) SACOL2623 (mqo2) malate:quinone oxidoreductase [4] (data from MRSA252) SACOL2116 (murAB) UDP-N-acetylglucosamine 1-carboxyvinyltransferase [4] (data from MRSA252) SACOL0792 (nrdE) ribonucleotide-diphosphate reductase subunit alpha [4] (data from MRSA252) SACOL1285 (nusA) transcription elongation factor NusA [4] (data from MRSA252) SACOL1102 (pdhA) pyruvate dehydrogenase complex E1 component subunit alpha [4] (data from MRSA252) SACOL1105 (pdhD) dihydrolipoamide dehydrogenase [4] (data from MRSA252) SACOL2128 (pdp) pyrimidine-nucleoside phosphorylase [4] (data from MRSA252) SACOL0204 (pflB) formate acetyltransferase [4] (data from MRSA252) SACOL1745 (pyk) pyruvate kinase [4] (data from MRSA252) SACOL0584 (rplA) 50S ribosomal protein L1 [4] (data from MRSA252) SACOL2236 (rplB) 50S ribosomal protein L2 [4] (data from MRSA252) SACOL2239 (rplC) 50S ribosomal protein L3 [4] (data from MRSA252) SACOL2227 (rplE) 50S ribosomal protein L5 [4] (data from MRSA252) SACOL2224 (rplF) 50S ribosomal protein L6 [4] (data from MRSA252) SACOL0585 (rplJ) 50S ribosomal protein L10 [4] (data from MRSA252) SACOL0583 (rplK) 50S ribosomal protein L11 [4] (data from MRSA252) SACOL0586 (rplL) 50S ribosomal protein L7/L12 [4] (data from MRSA252) SACOL2220 (rplO) 50S ribosomal protein L15 [4] (data from MRSA252) SACOL1257 (rplS) 50S ribosomal protein L19 [4] (data from MRSA252) SACOL1725 (rplT) 50S ribosomal protein L20 [4] (data from MRSA252) SACOL1702 (rplU) 50S ribosomal protein L21 [4] (data from MRSA252) SACOL2234 (rplV) 50S ribosomal protein L22 [4] (data from MRSA252) SACOL2237 (rplW) 50S ribosomal protein L23 [4] (data from MRSA252) SACOL0545 (rplY) 50S ribosomal protein L25/general stress protein Ctc [4] (data from MRSA252) SACOL1700 (rpmA) 50S ribosomal protein L27 [4] (data from MRSA252) SACOL1274 (rpsB) 30S ribosomal protein S2 [4] (data from MRSA252) SACOL2233 (rpsC) 30S ribosomal protein S3 [4] (data from MRSA252) SACOL1769 (rpsD) 30S ribosomal protein S4 [4] (data from MRSA252) SACOL2222 (rpsE) 30S ribosomal protein S5 [4] (data from MRSA252) SACOL0437 (rpsF) 30S ribosomal protein S6 [4] (data from MRSA252) SACOL0592 (rpsG) 30S ribosomal protein S7 [4] (data from MRSA252) SACOL2206 (rpsI) 30S ribosomal protein S9 [4] (data from MRSA252) SACOL2240 (rpsJ) 30S ribosomal protein S10 [4] (data from MRSA252) SACOL2214 (rpsK) 30S ribosomal protein S11 [4] (data from MRSA252) SACOL2215 (rpsM) 30S ribosomal protein S13 [4] (data from MRSA252) SACOL1254 (rpsP) 30S ribosomal protein S16 [4] (data from MRSA252) SACOL2235 (rpsS) 30S ribosomal protein S19 [4] (data from MRSA252) SACOL1448 (sucB) dihydrolipoamide succinyltransferase [4] (data from MRSA252) SACOL1262 (sucC) succinyl-CoA synthetase subunit beta [4] (data from MRSA252) SACOL0626 (thiD1) phosphomethylpyrimidine kinase [4] (data from MRSA252) SACOL0840 (tpiA) triosephosphate isomerase [4] (data from MRSA252) SACOL0594 (tuf) elongation factor Tu [4] (data from MRSA252) SACOL2104 (upp) uracil phosphoribosyltransferase [4] (data from MRSA252) SACOL0564 pyridoxal biosynthesis lyase PdxS [4] (data from MRSA252) SACOL0914 FeS assembly ATPase SufC [4] (data from MRSA252) SACOL0944 NADH dehydrogenase [4] (data from MRSA252) SACOL0973 fumarylacetoacetate hydrolase [4] (data from MRSA252) SACOL1759 universal stress protein [4] (data from MRSA252) SACOL1952 ferritins family protein [4] (data from MRSA252) SACOL2173 alkaline shock protein 23 [4] (data from MRSA252) SACOL2553 pyruvate oxidase [4] (data from MRSA252) SACOL2561 hydroxymethylglutaryl-CoA synthase [4] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ 4.00 4.01 4.02 4.03 4.04 4.05 4.06 4.07 4.08 4.09 4.10 4.11 4.12 4.13 4.14 4.15 4.16 4.17 4.18 4.19 4.20 4.21 4.22 4.23 4.24 4.25 4.26 4.27 4.28 4.29 4.30 4.31 4.32 4.33 4.34 4.35 4.36 4.37 4.38 4.39 4.40 4.41 4.42 4.43 4.44 4.45 4.46 4.47 4.48 4.49 4.50 4.51 4.52 4.53 4.54 4.55 4.56 4.57 4.58 4.59 4.60 4.61 4.62 4.63 4.64 4.65 4.66 4.67 4.68 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)