Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA1159 [new locus tag: SA_RS06580 ]
- pan locus tag?: SAUPAN003690000
- symbol: SA1159
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA1159 [new locus tag: SA_RS06580 ]
- symbol: SA1159
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1320385..1320987
- length: 603
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1123994 NCBI
- RefSeq: NP_374436 NCBI
- BioCyc: see SA_RS06580
- MicrobesOnline: 103462 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601ATGACATCTTTAATTATTGCAGAAGATCAAAATATGTTACGACAGGCAATGGTTCAATTA
ATTAAACTACATGGTGATTTTGAAATTTTAGCAGATACTGATAATGGTCTCGATGCAATG
AAACTTATTGAAGAATATAATCCTAACGTTGTTATTTTAGATATAGAAATGCCAGGCATG
ACTGGACTTGAAGTTTTAGCGGAAATTAGAAAAAAGCATTTGAATATTAAAGTGATTATT
GTAACAACTTTTAAAAGACCGGGATACTTTGAAAAAGCAGTTGTGAATGATGTGGATGCA
TATGTTTTAAAAGAACGTTCTATAGAAGAATTGGTGGAAACCATTAATAAAGTAAATAAC
GGAGAGAAAGAATATAGCGCCACATTGATGACTTCATTTTTTGTAGATAAAAACCCATTA
ACGCCCAAAGAACAAATTGTATTAAGGGAAATTGGCAATGGTTTAAGTAGTAAAGAAATA
AGTGAAAAATTATTTTTGACAGATGGAACAGTTAGAAATTATACATCTGTTATAATTGAT
AAATTATTTGCAGATAATCGTTTTGATGCTTGGAAAAAGGCAAATGAAAAAGGCTGGATC
TAA60
120
180
240
300
360
420
480
540
600
603
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA1159 [new locus tag: SA_RS06580 ]
- symbol: SA1159
- description: hypothetical protein
- length: 200
- theoretical pI: 4.76163
- theoretical MW: 22783.2
- GRAVY: -0.17
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Sporulation and germination sporulation transcription factor Spo0A (TIGR02875; HMM-score: 61.7)and 10 moreCentral intermediary metabolism Nitrogen metabolism nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 40.7)Regulatory functions DNA interactions nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 40.7)Signal transduction Two-component systems nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 40.7)Regulatory functions DNA interactions phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 37.2)Signal transduction Two-component systems phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 37.2)Regulatory functions DNA interactions heavy metal response regulator (TIGR01387; HMM-score: 34.8)transcriptional regulator EpsA (TIGR03020; HMM-score: 21.7)Regulatory functions DNA interactions PEP-CTERM-box response regulator transcription factor (TIGR02915; HMM-score: 18.1)Signal transduction Two-component systems TMAO reductase sytem sensor TorS (TIGR02956; EC 2.7.13.3; HMM-score: 16.1)RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 14.7)
- TheSEED :
- Two-component transcriptional response regulator, LuxR family
- PFAM: CheY (CL0304) Response_reg; Response regulator receiver domain (PF00072; HMM-score: 84.3)and 6 moreHTH (CL0123) GerE; Bacterial regulatory proteins, luxR family (PF00196; HMM-score: 45.3)Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 18)Ubiquitin (CL0072) SAP18; Sin3 associated polypeptide p18 (SAP18) (PF06487; HMM-score: 13.9)HTH (CL0123) Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 13.4)no clan defined GP44; Gene product 44 (PF17510; HMM-score: 12.9)HTH (CL0123) HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 12.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9937
- Cytoplasmic Membrane Score: 0.0028
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0034
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.001525
- TAT(Tat/SPI): 0.000108
- LIPO(Sec/SPII): 0.00018
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTSLIIAEDQNMLRQAMVQLIKLHGDFEILADTDNGLDAMKLIEEYNPNVVILDIEMPGMTGLEVLAEIRKKHLNIKVIIVTTFKRPGYFEKAVVNDVDAYVLKERSIEELVETINKVNNGEKEYSATLMTSFFVDKNPLTPKEQIVLREIGNGLSSKEISEKLFLTDGTVRNYTSVIIDKLFADNRFDAWKKANEKGWI
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
SA0033 (aadD) kanamycin nucleotidyltransferase [1] (data from MRSA252) SA1533 (ackA) acetate kinase [1] (data from MRSA252) SA2428 (arcA) arginine deiminase [1] (data from MRSA252) SA1984 (asp23) alkaline shock protein 23 [1] (data from MRSA252) SA1517 (citC) isocitrate dehydrogenase [1] (data from MRSA252) SA1409 (dnaK) molecular chaperone DnaK [1] (data from MRSA252) SA0002 (dnaN) DNA polymerase III subunit beta [1] (data from MRSA252) SA0731 (eno) phosphopyruvate hydratase [1] (data from MRSA252) SA0869 (fabI) enoyl-ACP reductase [1] (data from MRSA252) SA1553 (fhs) formate--tetrahydrofolate ligase [1] (data from MRSA252) SA1029 (ftsZ) cell division protein FtsZ [1] (data from MRSA252) SA0505 (fus) elongation factor G [1] (data from MRSA252) SA1510 (gapB) glyceraldehyde 3-phosphate dehydrogenase 2 [1] (data from MRSA252) SA1716 (gatA) aspartyl/glutamyl-tRNA amidotransferase subunit A [1] (data from MRSA252) SA1836 (groEL) molecular chaperone GroEL [1] (data from MRSA252) SA1305 (hu) DNA-binding protein II [1] (data from MRSA252) SA1112 (infB) translation initiation factor IF-2 [1] (data from MRSA252) SA0232 (lctE) L-lactate dehydrogenase [1] (data from MRSA252) SA2400 (mqo2) malate:quinone oxidoreductase [1] (data from MRSA252) SA1926 (murZ) UDP-N-acetylglucosamine 1-carboxyvinyltransferase [1] (data from MRSA252) SA2334 (mvaS) 3-hydroxy-3-methylglutaryl-CoA synthase [1] (data from MRSA252) SA0686 (nrdE) ribonucleotide-diphosphate reductase subunit alpha [1] (data from MRSA252) SA1109 (nusA) transcription elongation factor NusA [1] (data from MRSA252) SA1244 (odhB) dihydrolipoamide succinyltransferase [1] (data from MRSA252) SA0943-1 (pdhA) pyruvate dehydrogenase E1 component subunit alpha [1] (data from MRSA252) SA0946 (pdhD) dihydrolipoamide dehydrogenase [1] (data from MRSA252) SA1938 (pdp) pyrimidine-nucleoside phosphorylase [1] (data from MRSA252) SA0218 (pflB) formate acetyltransferase [1] (data from MRSA252) SA1520 (pykA) pyruvate kinase [1] (data from MRSA252) SA0496 (rplA) 50S ribosomal protein L1 [1] (data from MRSA252) SA2044 (rplB) 50S ribosomal protein L2 [1] (data from MRSA252) SA2047 (rplC) 50S ribosomal protein L3 [1] (data from MRSA252) SA2035 (rplE) 50S ribosomal protein L5 [1] (data from MRSA252) SA2033 (rplF) 50S ribosomal protein L6 [1] (data from MRSA252) SA0497 (rplJ) 50S ribosomal protein L10 [1] (data from MRSA252) SA0495 (rplK) 50S ribosomal protein L11 [1] (data from MRSA252) SA0498 (rplL) 50S ribosomal protein L7/L12 [1] (data from MRSA252) SA2029 (rplO) 50S ribosomal protein L15 [1] (data from MRSA252) SA1084 (rplS) 50S ribosomal protein L19 [1] (data from MRSA252) SA1502 (rplT) 50S ribosomal protein L20 [1] (data from MRSA252) SA1473 (rplU) 50S ribosomal protein L21 [1] (data from MRSA252) SA2042 (rplV) 50S ribosomal protein L22 [1] (data from MRSA252) SA2045 (rplW) 50S ribosomal protein L23 [1] (data from MRSA252) SA0459 (rplY) 50S ribosomal protein L25 [1] (data from MRSA252) SA1471 (rpmA) 50S ribosomal protein L27 [1] (data from MRSA252) SA1099 (rpsB) 30S ribosomal protein S2 [1] (data from MRSA252) SA2041 (rpsC) 30S ribosomal protein S3 [1] (data from MRSA252) SAS052 (rpsD) 30S ribosomal protein S4 [1] (data from MRSA252) SA2031 (rpsE) 30S ribosomal protein S5 [1] (data from MRSA252) SA0352 (rpsF) 30S ribosomal protein S6 [1] (data from MRSA252) SA0504 (rpsG) 30S ribosomal protein S7 [1] (data from MRSA252) SA2016 (rpsI) 30S ribosomal protein S9 [1] (data from MRSA252) SA2048 (rpsJ) 30S ribosomal protein S10 [1] (data from MRSA252) SA2024 (rpsK) 30S ribosomal protein S11 [1] (data from MRSA252) SA2025 (rpsM) 30S ribosomal protein S13 [1] (data from MRSA252) SA1081 (rpsP) 30S ribosomal protein S16 [1] (data from MRSA252) SA2043 (rpsS) 30S ribosomal protein S19 [1] (data from MRSA252) SA1088 (sucC) succinyl-CoA synthetase subunit beta [1] (data from MRSA252) SA0729 (tpiA) triosephosphate isomerase [1] (data from MRSA252) SA0506 (tuf) elongation factor Tu [1] (data from MRSA252) SA1914 (upp) uracil phosphoribosyltransferase [1] (data from MRSA252) SA0477 pyridoxal biosynthesis lyase PdxS [1] (data from MRSA252) SA0537 phosphomethylpyrimidine kinase [1] (data from MRSA252) SA0774 hypothetical protein [1] (data from MRSA252) SA0802 hypothetical protein [1] (data from MRSA252) SA0829 hypothetical protein [1] (data from MRSA252) SA1271 threonine dehydratase [1] (data from MRSA252) SA1532 hypothetical protein [1] (data from MRSA252) SA1709 hypothetical protein [1] (data from MRSA252) SA2327 pyruvate oxidase [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SA1156 > SA1157 > SA1158 > SA1159
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 1.45 1.46 1.47 1.48 1.49 1.50 1.51 1.52 1.53 1.54 1.55 1.56 1.57 1.58 1.59 1.60 1.61 1.62 1.63 1.64 1.65 1.66 1.67 1.68 1.69 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)