From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS04500 [old locus tag: SACOL0877 ]
  • pan locus tag?: SAUPAN002821000
  • symbol: SACOL_RS04500
  • pan gene symbol?: gcvH
  • synonym:
  • product: glycine cleavage system protein H

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS04500 [old locus tag: SACOL0877 ]
  • symbol: SACOL_RS04500
  • product: glycine cleavage system protein H
  • replicon: chromosome
  • strand: +
  • coordinates: 897692..898072
  • length: 381
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (897692..898072) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    TTGGCAGTACCAAATGAATTGAAATATTCAAAAGAGCATGAATGGGTTAAAGTTGAAGGT
    AATGTAGCAATAATTGGAATCACAGAATACGCACAAAGCGAGTTAGGTGATATTGTTTTC
    GTTGAATTACCAGAAACAGATGATGAAATTAATGAAGGGGATACGTTTGGTAGCGTAGAA
    TCAGTTAAAACTGTATCAGAATTATATGCACCAATCTCTGGTAAAGTAGTTGAAGTCAAC
    GAAGAACTAGAAGATAGTCCCGAATTTGTAAATGAATCTCCATACGAAAAAGCATGGATG
    GTAAAAGTAGAAATTAGTGATGAAAGTCAGATTGAAGCTTTATTAACAGCTGAAAAATAT
    TCAGAAATGATTGGTGAATAA
    60
    120
    180
    240
    300
    360
    381

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS04500 [old locus tag: SACOL0877 ]
  • symbol: SACOL_RS04500
  • description: glycine cleavage system protein H
  • length: 126
  • theoretical pI: 3.70004
  • theoretical MW: 14092.5
  • GRAVY: -0.333333

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismEnergy metabolismAmino acids and aminesglycine cleavage system H protein (TIGR00527; HMM-score: 184.5)
    glycine cleavage protein H-like protein (TIGR03077; HMM-score: 69.5)
    MetabolismFatty acid and phospholipid metabolismBiosynthesisacetyl-CoA carboxylase, biotin carboxyl carrier protein (TIGR00531; HMM-score: 15.2)
    MetabolismCentral intermediary metabolismNitrogen metabolismurea carboxylase (TIGR02712; EC 6.3.4.6; HMM-score: 11.1)
  • TheSEED:
  • PFAM:
    Hybrid (CL0105) GCV_H; Glycine cleavage H-protein (PF01597; HMM-score: 164.8)
    Biotin_lipoyl; Biotin-requiring enzyme (PF00364; HMM-score: 16.5)
    RnfC_N; RnfC Barrel sandwich hybrid domain (PF13375; HMM-score: 16.4)

Structure, modifications & interactions[edit source | edit]

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.118
    • Ymax_pos: 11
    • Cmax: 0.125
    • Cmax_pos: 34
    • Smax: 0.156
    • Smax_pos: 6
    • Smean: 0.137
    • D: 0.125
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446212630 NCBI
  • RefSeq: WP_000290485 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MAVPNELKYSKEHEWVKVEGNVAIIGITEYAQSELGDIVFVELPETDDEINEGDTFGSVESVKTVSELYAPISGKVVEVNEELEDSPEFVNESPYEKAWMVKVEISDESQIEALLTAEKYSEMIGE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS04500 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26

Relevant publications[edit source | edit]