Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_RS03580 [old locus tag: NWMN_0630 ]
- pan locus tag?: SAUPAN002540000
- symbol: NWMN_RS03580
- pan gene symbol?: vraF
- synonym:
- product: ABC transporter ATP-binding protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_RS03580 [old locus tag: NWMN_0630 ]
- symbol: NWMN_RS03580
- product: ABC transporter ATP-binding protein
- replicon: chromosome
- strand: +
- coordinates: 711227..711988
- length: 762
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721GTGGCAATTTTAGAAGTAAAACAATTAACAAAAATATATGGAACTAAAAAAATGGCACAA
GAAGTGTTGCGAGATATCAATATGTCTATTGAAGAAGGCGAGTTTATTGCTATTATGGGT
CCCTCTGGATCTGGGAAAACGACATTATTAAATGTTTTAAGTTCAATTGATTATATTTCA
CAAGGTTCTATTACATTAAAAGGAAAAAAATTAGAAAAGCTTTCAAACAAGGAATTATCT
GATATACGCAAGCATGATATTGGTTTTATTTTTCAAGAGTATAATTTACTGCATACATTG
ACTGTTAAAGAAAACATAATGTTACCACTAACGGTACAGAAGTTAGATAAAGAACATATG
TTAAATCGTTATGAAAAAGTAGCAGAAGCATTAAATATATTGGATATTAGTGATAAATAT
CCCTCTGAATTGTCTGGTGGACAAAGGCAACGAACATCAGCTGCCAGAGCATTTATAACA
TTGCCTTCTATTATATTTGCTGACGAACCAACAGGTGCACTGGATTCTAAAAGTACTCAA
GATTTATTAAAACGATTAACAAGAATGAATGAAGCATTTAAGTCTACAATTATTATGGTA
ACGCATGATCCTGTTGCAGCAAGCTATGCAAATCGAGTAGTGATGCTAAAAGATGGTCAA
ATTTTCACTGAATTATACCAAGGGGATGACGATAAACATACCTTTTTCAAAGAAATAATA
CGTGTACAAAGTGTTTTAGGTGGCGTTAATTATGACCTTTAA60
120
180
240
300
360
420
480
540
600
660
720
762
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_RS03580 [old locus tag: NWMN_0630 ]
- symbol: NWMN_RS03580
- description: ABC transporter ATP-binding protein
- length: 253
- theoretical pI: 7.0941
- theoretical MW: 28462.7
- GRAVY: -0.209881
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 215.8)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 207.8)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 207.8)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 202.5)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 185.8)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 179.7)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 179.4)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 176.4)and 82 moreTransport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 158.1)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 152.4)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 149.7)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 149.1)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 143.6)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 134.1)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 132.9)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 131.9)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 131.9)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 131.4)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 131.2)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 131)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 127.1)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 126.9)Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 126.2)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 125.2)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 125.2)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 122)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 120.1)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 119.6)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 118)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 116.4)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 116)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 113.5)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 113.5)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 110.8)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 110.8)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 108.4)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 102.5)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 102.5)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 101.9)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 99.4)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 96.6)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 96.5)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 96.4)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 94.1)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 93.6)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 93.6)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 91.2)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 90.9)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 89.5)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 89.5)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 89.3)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 89.3)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 89.3)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 87)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 86.3)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 85.5)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 84.7)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 77.6)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 75.3)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 72.3)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 71.7)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 67.2)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 63.9)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 63.9)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 56.4)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 49.9)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 49.9)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 45.3)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 40)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 38.9)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 37.1)Unknown function General small GTP-binding protein domain (TIGR00231; HMM-score: 17.8)Central intermediary metabolism Phosphorus compounds phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN (TIGR02322; HMM-score: 17.5)Purines, pyrimidines, nucleosides, and nucleotides Nucleotide and nucleoside interconversions dTMP kinase (TIGR00041; EC 2.7.4.9; HMM-score: 14.8)Protein synthesis tRNA and rRNA base modification tRNA 2-selenouridine synthase (TIGR03167; EC 2.9.1.-; HMM-score: 14.5)DNA metabolism DNA replication, recombination, and repair DnaA regulatory inactivator Hda (TIGR03420; HMM-score: 14.3)type IV secretion/conjugal transfer ATPase, VirB4 family (TIGR00929; HMM-score: 14.2)Cellular processes Chemotaxis and motility flagellar biosynthesis protein FlhF (TIGR03499; HMM-score: 14.2)DNA metabolism DNA replication, recombination, and repair exonuclease SbcC (TIGR00618; HMM-score: 13.7)P-type DNA transfer ATPase VirB11 (TIGR02788; HMM-score: 13.5)Cellular processes Pathogenesis type II secretion system protein E (TIGR02533; HMM-score: 13.2)Protein fate Protein and peptide secretion and trafficking type II secretion system protein E (TIGR02533; HMM-score: 13.2)Biosynthesis of cofactors, prosthetic groups, and carriers Molybdopterin molybdopterin-guanine dinucleotide biosynthesis protein B (TIGR00176; HMM-score: 13.1)helicase/secretion neighborhood ATPase (TIGR03819; HMM-score: 13.1)Cell envelope Surface structures twitching motility protein (TIGR01420; HMM-score: 12.9)Cellular processes Chemotaxis and motility twitching motility protein (TIGR01420; HMM-score: 12.9)DNA metabolism DNA replication, recombination, and repair Holliday junction DNA helicase RuvB (TIGR00635; EC 3.6.4.12; HMM-score: 12.5)Purines, pyrimidines, nucleosides, and nucleotides Nucleotide and nucleoside interconversions guanylate kinase (TIGR03263; EC 2.7.4.8; HMM-score: 12.3)Cellular processes Conjugation P-type conjugative transfer ATPase TrbB (TIGR02782; HMM-score: 11.8)DNA metabolism DNA replication, recombination, and repair checkpoint protein rad24 (TIGR00602; HMM-score: 11.4)
- TheSEED: see NWMN_0630
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 114.7)and 32 moreSMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 35.4)AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 30.6)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 23.1)AAA_25; AAA domain (PF13481; HMM-score: 19.6)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 19.2)nSTAND3; Novel STAND NTPase 3 (PF20720; HMM-score: 19.2)AAA_16; AAA ATPase domain (PF13191; HMM-score: 19)AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 18.8)Rad17; Rad17 P-loop domain (PF03215; HMM-score: 18.2)AAA_22; AAA domain (PF13401; HMM-score: 18.1)AAA_18; AAA domain (PF13238; HMM-score: 17.8)ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 17.6)AAA_23; AAA domain (PF13476; HMM-score: 16.5)AAA_28; AAA domain (PF13521; HMM-score: 16.4)nSTAND1; Novel STAND NTPase 1 (PF20703; HMM-score: 16.3)NB-ARC; NB-ARC domain (PF00931; HMM-score: 15.9)NACHT; NACHT domain (PF05729; HMM-score: 15.6)VapE-like_dom; Virulence-associated protein E-like domain (PF05272; HMM-score: 14.1)AAA_14; AAA domain (PF13173; HMM-score: 13.9)T2SSE; Type II/IV secretion system protein (PF00437; HMM-score: 13.8)MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 13.7)DO-GTPase2; Double-GTPase 2 (PF19993; HMM-score: 13.7)cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 13.5)AAA_30; AAA domain (PF13604; HMM-score: 13.5)TsaE; Threonylcarbamoyl adenosine biosynthesis protein TsaE (PF02367; HMM-score: 13.3)PhoH; PhoH-like protein (PF02562; HMM-score: 13.2)Adeno_IVa2; Adenovirus IVa2 protein (PF02456; HMM-score: 12.9)PRK; Phosphoribulokinase / Uridine kinase family (PF00485; HMM-score: 12.4)ATP-synt_ab; ATP synthase alpha/beta family, nucleotide-binding domain (PF00006; HMM-score: 12.2)AAA_24; AAA domain (PF13479; HMM-score: 12.2)RNA_helicase; RNA helicase (PF00910; HMM-score: 12)AAA_11; AAA domain (PF13086; HMM-score: 11.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 1.05
- Cytoplasmic Membrane Score: 8.78
- Cellwall Score: 0.08
- Extracellular Score: 0.09
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.06
- Cytoplasmic Membrane Score: 0.9331
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0066
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003923
- TAT(Tat/SPI): 0.00028
- LIPO(Sec/SPII): 0.000354
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MAILEVKQLTKIYGTKKMAQEVLRDINMSIEEGEFIAIMGPSGSGKTTLLNVLSSIDYISQGSITLKGKKLEKLSNKELSDIRKHDIGFIFQEYNLLHTLTVKENIMLPLTVQKLDKEHMLNRYEKVAEALNILDISDKYPSELSGGQRQRTSAARAFITLPSIIFADEPTGALDSKSTQDLLKRLTRMNEAFKSTIIMVTHDPVAASYANRVVMLKDGQIFTELYQGDDDKHTFFKEIIRVQSVLGGVNYDL
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
NWMN_RS11780 (deoA) pyrimidine-nucleoside phosphorylase [1] (data from MRSA252) NWMN_RS10565 (gatA) glutamyl-tRNA(Gln) amidotransferase subunit A [1] (data from MRSA252) NWMN_RS06630 (nusA) transcription termination/antitermination protein NusA [1] (data from MRSA252) NWMN_RS00075 50S ribosomal protein L9 [1] (data from MRSA252) NWMN_RS00315 peptidoglycan-binding protein LysM [1] (data from MRSA252) NWMN_RS00465 2-deoxyribose-5-phosphate aldolase [1] (data from MRSA252) NWMN_RS00885 formate acetyltransferase [1] (data from MRSA252) NWMN_RS00980 L-lactate dehydrogenase [1] (data from MRSA252) NWMN_RS01965 acetyl-CoA acyltransferase [1] (data from MRSA252) NWMN_RS02020 30S ribosomal protein S6 [1] (data from MRSA252) NWMN_RS02105 alkyl hydroperoxide reductase subunit C [1] (data from MRSA252) NWMN_RS02150 IMP dehydrogenase [1] (data from MRSA252) NWMN_RS02155 GMP synthase (glutamine-hydrolyzing) [1] (data from MRSA252) NWMN_RS02505 YbaB/EbfC family nucleoid-associated protein [1] (data from MRSA252) NWMN_RS02645 ribose-phosphate pyrophosphokinase [1] (data from MRSA252) NWMN_RS02655 50S ribosomal protein L25/general stress protein Ctc [1] (data from MRSA252) NWMN_RS02715 cysteine synthase [1] (data from MRSA252) NWMN_RS02815 pyridoxal 5'-phosphate synthase lyase subunit PdxS [1] (data from MRSA252) NWMN_RS02820 pyridoxal 5'-phosphate synthase glutaminase subunit PdxT [1] (data from MRSA252) NWMN_RS02905 transcription termination/antitermination protein NusG [1] (data from MRSA252) NWMN_RS02910 50S ribosomal protein L11 [1] (data from MRSA252) NWMN_RS02915 50S ribosomal protein L1 [1] (data from MRSA252) NWMN_RS02920 50S ribosomal protein L10 [1] (data from MRSA252) NWMN_RS02925 50S ribosomal protein L7/L12 [1] (data from MRSA252) NWMN_RS02935 DNA-directed RNA polymerase subunit beta [1] (data from MRSA252) NWMN_RS02940 DNA-directed RNA polymerase subunit beta' [1] (data from MRSA252) NWMN_RS02955 30S ribosomal protein S7 [1] (data from MRSA252) NWMN_RS02960 elongation factor G [1] (data from MRSA252) NWMN_RS02965 elongation factor Tu [1] (data from MRSA252) NWMN_RS02995 branched chain amino acid aminotransferase [1] (data from MRSA252) NWMN_RS03160 phosphate acetyltransferase [1] (data from MRSA252) NWMN_RS03715 MarR family transcriptional regulator [1] (data from MRSA252) NWMN_RS03965 ribonucleotide-diphosphate reductase subunit beta [1] (data from MRSA252) NWMN_RS04075 ribosomal subunit interface protein [1] (data from MRSA252) NWMN_RS04175 ATP-dependent Clp protease proteolytic subunit [1] (data from MRSA252) NWMN_RS04195 aldehyde dehydrogenase [1] (data from MRSA252) NWMN_RS04200 phosphoglycerate kinase [1] (data from MRSA252) NWMN_RS04205 triose-phosphate isomerase [1] (data from MRSA252) NWMN_RS04210 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [1] (data from MRSA252) NWMN_RS04215 enolase [1] (data from MRSA252) NWMN_RS04385 glycine cleavage system protein H [1] (data from MRSA252) NWMN_RS04555 D-alanine--poly(phosphoribitol) ligase subunit 2 [1] (data from MRSA252) NWMN_RS04590 NADH dehydrogenase [1] (data from MRSA252) NWMN_RS04675 NAD-specific glutamate dehydrogenase [1] (data from MRSA252) NWMN_RS04700 glucose-6-phosphate isomerase [1] (data from MRSA252) NWMN_RS04730 hypothetical protein [1] (data from MRSA252) NWMN_RS04805 beta-ketoacyl-[acyl-carrier-protein] synthase II [1] (data from MRSA252) NWMN_RS04885 oligoendopeptidase F [1] (data from MRSA252) NWMN_RS04955 hypothetical protein [1] (data from MRSA252) NWMN_RS05220 bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase [1] (data from MRSA252) NWMN_RS05320 phosphocarrier protein HPr [1] (data from MRSA252) NWMN_RS05325 phosphoenolpyruvate--protein phosphotransferase [1] (data from MRSA252) NWMN_RS05380 pyruvate dehydrogenase E1 component subunit alpha [1] (data from MRSA252) NWMN_RS05390 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex [1] (data from MRSA252) NWMN_RS05395 dihydrolipoyl dehydrogenase [1] (data from MRSA252) NWMN_RS05940 phenylalanine--tRNA ligase subunit beta [1] (data from MRSA252) NWMN_RS05970 thiol reductase thioredoxin [1] (data from MRSA252) NWMN_RS06210 cell division protein FtsZ [1] (data from MRSA252) NWMN_RS06435 beta-ketoacyl-ACP reductase [1] (data from MRSA252) NWMN_RS06490 50S ribosomal protein L19 [1] (data from MRSA252) NWMN_RS06515 succinyl-CoA ligase subunit beta [1] (data from MRSA252) NWMN_RS06520 succinyl-CoA ligase subunit alpha [1] (data from MRSA252) NWMN_RS06565 GTP-sensing pleiotropic transcriptional regulator CodY [1] (data from MRSA252) NWMN_RS06575 30S ribosomal protein S2 [1] (data from MRSA252) NWMN_RS06585 elongation factor Ts [1] (data from MRSA252) NWMN_RS06595 ribosome-recycling factor [1] (data from MRSA252) NWMN_RS06840 glutamine synthetase [1] (data from MRSA252) NWMN_RS07080 transketolase [1] (data from MRSA252) NWMN_RS07120 aconitate hydratase [1] (data from MRSA252) NWMN_RS07455 dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex [1] (data from MRSA252) NWMN_RS07515 glucose-specific phosphotransferase enzyme IIA component [1] (data from MRSA252) NWMN_RS07520 peptide-methionine (R)-S-oxide reductase [1] (data from MRSA252) NWMN_RS07785 DNA-binding protein HU [1] (data from MRSA252) NWMN_RS07800 30S ribosomal protein S1 [1] (data from MRSA252) NWMN_RS08000 phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating) [1] (data from MRSA252) NWMN_RS08125 glycine dehydrogenase [1] (data from MRSA252) NWMN_RS08215 superoxide dismutase [1] (data from MRSA252) NWMN_RS08275 glycine--tRNA ligase [1] (data from MRSA252) NWMN_RS08350 molecular chaperone DnaK [1] (data from MRSA252) NWMN_RS08525 hypothetical protein [1] (data from MRSA252) NWMN_RS08685 50S ribosomal protein L21 [1] (data from MRSA252) NWMN_RS08795 trigger factor [1] (data from MRSA252) NWMN_RS08865 aldehyde dehydrogenase [1] (data from MRSA252) NWMN_RS08905 isocitrate dehydrogenase (NADP(+)) [1] (data from MRSA252) NWMN_RS08910 citrate synthase [1] (data from MRSA252) NWMN_RS08930 pyruvate kinase [1] (data from MRSA252) NWMN_RS08935 ATP-dependent 6-phosphofructokinase [1] (data from MRSA252) NWMN_RS08970 universal stress protein [1] (data from MRSA252) NWMN_RS08980 dipeptidase [1] (data from MRSA252) NWMN_RS08995 universal stress protein UspA [1] (data from MRSA252) NWMN_RS09000 acetate kinase [1] (data from MRSA252) NWMN_RS09045 30S ribosomal protein S4 [1] (data from MRSA252) NWMN_RS09125 formate--tetrahydrofolate ligase [1] (data from MRSA252) NWMN_RS09230 dipeptidase PepV [1] (data from MRSA252) NWMN_RS09385 transaldolase [1] (data from MRSA252) NWMN_RS10520 non-heme ferritin [1] (data from MRSA252) NWMN_RS10560 aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [1] (data from MRSA252) NWMN_RS10670 manganese-dependent inorganic pyrophosphatase [1] (data from MRSA252) NWMN_RS11175 molecular chaperone GroEL [1] (data from MRSA252) NWMN_RS11655 uracil phosphoribosyltransferase [1] (data from MRSA252) NWMN_RS11660 serine hydroxymethyltransferase [1] (data from MRSA252) NWMN_RS11720 fructose-bisphosphate aldolase [1] (data from MRSA252) NWMN_RS11795 purine-nucleoside phosphorylase [1] (data from MRSA252) NWMN_RS11875 glutamine--fructose-6-phosphate aminotransferase [1] (data from MRSA252) NWMN_RS12080 Asp23/Gls24 family envelope stress response protein [1] (data from MRSA252) NWMN_RS12260 30S ribosomal protein S9 [1] (data from MRSA252) NWMN_RS12265 50S ribosomal protein L13 [1] (data from MRSA252) NWMN_RS12290 50S ribosomal protein L17 [1] (data from MRSA252) NWMN_RS12300 30S ribosomal protein S11 [1] (data from MRSA252) NWMN_RS12320 adenylate kinase [1] (data from MRSA252) NWMN_RS12330 50S ribosomal protein L15 [1] (data from MRSA252) NWMN_RS12340 30S ribosomal protein S5 [1] (data from MRSA252) NWMN_RS12350 50S ribosomal protein L6 [1] (data from MRSA252) NWMN_RS12355 30S ribosomal protein S8 [1] (data from MRSA252) NWMN_RS12365 50S ribosomal protein L5 [1] (data from MRSA252) NWMN_RS12380 30S ribosomal protein S17 [1] (data from MRSA252) NWMN_RS12395 30S ribosomal protein S3 [1] (data from MRSA252) NWMN_RS12400 50S ribosomal protein L22 [1] (data from MRSA252) NWMN_RS12405 30S ribosomal protein S19 [1] (data from MRSA252) NWMN_RS12410 50S ribosomal protein L2 [1] (data from MRSA252) NWMN_RS12415 50S ribosomal protein L23 [1] (data from MRSA252) NWMN_RS12420 50S ribosomal protein L4 [1] (data from MRSA252) NWMN_RS12425 50S ribosomal protein L3 [1] (data from MRSA252) NWMN_RS12430 30S ribosomal protein S10 [1] (data from MRSA252) NWMN_RS13925 lactate dehydrogenase [1] (data from MRSA252) NWMN_RS14010 pyruvate oxidase [1] (data from MRSA252) NWMN_RS14365 class I fructose-bisphosphate aldolase [1] (data from MRSA252) NWMN_RS14370 malate:quinone oxidoreductase [1] (data from MRSA252) NWMN_RS14560 arginine deiminase [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.000 1.001 1.002 1.003 1.004 1.005 1.006 1.007 1.008 1.009 1.010 1.011 1.012 1.013 1.014 1.015 1.016 1.017 1.018 1.019 1.020 1.021 1.022 1.023 1.024 1.025 1.026 1.027 1.028 1.029 1.030 1.031 1.032 1.033 1.034 1.035 1.036 1.037 1.038 1.039 1.040 1.041 1.042 1.043 1.044 1.045 1.046 1.047 1.048 1.049 1.050 1.051 1.052 1.053 1.054 1.055 1.056 1.057 1.058 1.059 1.060 1.061 1.062 1.063 1.064 1.065 1.066 1.067 1.068 1.069 1.070 1.071 1.072 1.073 1.074 1.075 1.076 1.077 1.078 1.079 1.080 1.081 1.082 1.083 1.084 1.085 1.086 1.087 1.088 1.089 1.090 1.091 1.092 1.093 1.094 1.095 1.096 1.097 1.098 1.099 1.100 1.101 1.102 1.103 1.104 1.105 1.106 1.107 1.108 1.109 1.110 1.111 1.112 1.113 1.114 1.115 1.116 1.117 1.118 1.119 1.120 1.121 1.122 1.123 1.124 1.125 1.126 1.127 1.128 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)