Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA1303 [new locus tag: SA_RS07370 ]
- pan locus tag?: SAUPAN003931000
- symbol: ubiE
- pan gene symbol?: ubiE
- synonym:
- product: ubiquinone/menaquinone biosynthesis methyltransferase
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA1303 [new locus tag: SA_RS07370 ]
- symbol: ubiE
- product: ubiquinone/menaquinone biosynthesis methyltransferase
- replicon: chromosome
- strand: -
- coordinates: 1508979..1509704
- length: 726
- essential: yes DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1124142 NCBI
- RefSeq: NP_374585 NCBI
- BioCyc: see SA_RS07370
- MicrobesOnline: 103611 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721ATGGCTGACAATAAAGCAAATAAAGAGCAAGTACATCGCGTTTTTCAAAATATTTCAAAA
AAATATGATAGATTAAATAATATTATTAGTTTTGAGCAGCATAAAGTATGGAGAAAACGC
GTCATGAAAGACATGGGTGTTAGAAAAGGGACGAAAGCATTAGATGTTTGTTGTGGTACT
GGTGATTGGACAATCGCATTAAGCAAAGCTGTAGGACCAACAGGTGAAGTTACTGGTATT
GACTTTAGTGAGAATATGTTAGAAGTAGGAAAAGAAAAAACTGCTTCAATGGAAAATGTT
AAACTTGTTCATGGTGATGCAATGGAATTGCCGTTTGAAGACAATTCTTTTGATTATGTA
ACAATTGGGTTTGGATTAAGAAATGTGCCAGACTATTTAGTCGCGTTAAAAGAAATGAAT
AGAGTACTTAAACCAGGTGGTATGGTGGTATGTCTTGAAACGAGCCAACCAACTTTGCCA
GTCTTTAAACAAATGTATGCACTATACTTTAAATTTGTTATGCCTATTTTTGGAAAATTA
TTTGCAAAATCAAAAGAAGAATATGAATGGTTACAGCAATCTACGTTTAATTTTCCTGGA
AAAGAAGAGTTGAAGCGCATGTTTGAAGAAGCAGGTTTCATAAATGTAAGAGTACGTAGT
TTTACAGGGGGCGTTGCTGCAATGCACCTTGGCTATAAAGAAAAAGATAATACCAAAGGT
GATTAA60
120
180
240
300
360
420
480
540
600
660
720
726
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA1303 [new locus tag: SA_RS07370 ]
- symbol: UbiE
- description: ubiquinone/menaquinone biosynthesis methyltransferase
- length: 241
- theoretical pI: 9.02909
- theoretical MW: 27422.5
- GRAVY: -0.378838
⊟Function[edit | edit source]
- reaction: EC 2.1.1.163? ExPASyDemethylmenaquinone methyltransferase A demethylmenaquinol + S-adenosyl-L-methionine = a menaquinol + S-adenosyl-L-homocysteine
- TIGRFAM: Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone demethylmenaquinone methyltransferase (TIGR02752; EC 2.1.1.163; HMM-score: 402.2)and 23 moreBiosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone ubiquinone/menaquinone biosynthesis methyltransferase (TIGR01934; EC 2.1.1.-; HMM-score: 300.9)Biosynthesis of cofactors, prosthetic groups, and carriers Biotin malonyl-acyl carrier protein O-methyltransferase BioC (TIGR02072; EC 2.1.1.-; HMM-score: 64.7)Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit (TIGR02469; EC 2.1.1.132; HMM-score: 41.7)Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone 3-demethylubiquinone-9 3-O-methyltransferase (TIGR01983; EC 2.1.1.64; HMM-score: 36.6)Biosynthesis of cofactors, prosthetic groups, and carriers Glutathione and analogs putative 4-mercaptohistidine N1-methyltranferase (TIGR04345; HMM-score: 36.5)Protein fate Protein modification and repair protein-(glutamine-N5) methyltransferase, release factor-specific (TIGR03534; EC 2.1.1.-; HMM-score: 31.4)Unknown function Enzymes of unknown specificity tRNA (cmo5U34)-methyltransferase (TIGR00740; EC 2.1.1.-; HMM-score: 31.3)Biosynthesis of cofactors, prosthetic groups, and carriers Chlorophyll and bacteriochlorphyll magnesium protoporphyrin O-methyltransferase (TIGR02021; EC 2.1.1.11; HMM-score: 30)methyltransferase, FxLD system (TIGR04364; HMM-score: 28.8)Protein fate Protein modification and repair protein-L-isoaspartate O-methyltransferase (TIGR00080; EC 2.1.1.77; HMM-score: 27.2)Amino acid biosynthesis Aspartate family methionine biosynthesis protein MetW (TIGR02081; HMM-score: 23.8)Protein synthesis tRNA and rRNA base modification ribosomal RNA small subunit methyltransferase A (TIGR00755; EC 2.1.1.182; HMM-score: 23.2)Protein fate Protein modification and repair methyltransferase, HemK family (TIGR00536; HMM-score: 21.6)Protein synthesis Ribosomal proteins: synthesis and modification protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific (TIGR03533; EC 2.1.1.-; HMM-score: 20.5)Protein synthesis tRNA and rRNA base modification ribosomal RNA large subunit methyltransferase J (TIGR00438; EC 2.1.1.166; HMM-score: 16.6)Protein synthesis tRNA and rRNA base modification tRNA (guanine-N(7)-)-methyltransferase (TIGR00091; EC 2.1.1.33; HMM-score: 15.9)Protein synthesis tRNA and rRNA base modification 23S rRNA (uracil-5-)-methyltransferase RumA (TIGR00479; EC 2.1.1.-; HMM-score: 15.5)Unknown function Enzymes of unknown specificity tRNA (mo5U34)-methyltransferase (TIGR00452; EC 2.1.1.-; HMM-score: 15.3)methyltransferase, ATP-grasp peptide maturase system (TIGR04188; HMM-score: 13.6)methyltransferase, Rta_06860 family (TIGR04290; EC 2.1.1.-; HMM-score: 12.7)Hypothetical proteins Conserved putative methyltransferase, TIGR01177 family (TIGR01177; HMM-score: 12.3)2-ketoarginine methyltransferase (TIGR04543; EC 2.1.1.243; HMM-score: 11.8)Protein synthesis Ribosomal proteins: synthesis and modification putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific (TIGR03704; EC 2.1.1.-; HMM-score: 11.3)
- TheSEED :
- 2-heptaprenyl-1,4-naphthoquinone methyltransferase (EC 2.1.1.163)
- 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase (EC 2.1.1.201)
Cofactors, Vitamins, Prosthetic Groups, Pigments Quinone cofactors Menaquinone and Phylloquinone Biosynthesis Ubiquinone/menaquinone biosynthesis methyltransferase UbiE (EC 2.1.1.-)and 1 more - PFAM: NADP_Rossmann (CL0063) Ubie_methyltran; ubiE/COQ5 methyltransferase family (PF01209; HMM-score: 328.3)and 21 moreMethyltransf_25; Methyltransferase domain (PF13649; HMM-score: 94.3)Methyltransf_11; Methyltransferase domain (PF08241; HMM-score: 88.5)Methyltransf_31; Methyltransferase domain (PF13847; HMM-score: 86.4)Methyltransf_23; Methyltransferase domain (PF13489; HMM-score: 63.5)Methyltransf_12; Methyltransferase domain (PF08242; HMM-score: 59.8)PCMT; Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) (PF01135; HMM-score: 39.4)FtsJ; FtsJ-like methyltransferase (PF01728; HMM-score: 36.7)Methyltransf_4; Putative methyltransferase (PF02390; HMM-score: 28.2)MetW; Methionine biosynthesis protein MetW (PF07021; HMM-score: 23.1)CMAS; Mycolic acid cyclopropane synthetase (PF02353; HMM-score: 21.4)Methyltransf_8; Hypothetical methyltransferase (PF05148; HMM-score: 20.9)GCD14; tRNA methyltransferase complex GCD14 subunit (PF08704; HMM-score: 20.1)RrnaAD; Ribosomal RNA adenine dimethylase (PF00398; HMM-score: 19.6)MTS; Methyltransferase small domain (PF05175; HMM-score: 19.5)Rsm22; Mitochondrial small ribosomal subunit Rsm22 (PF09243; HMM-score: 18.4)Methyltransf_24; Methyltransferase domain (PF13578; HMM-score: 18.2)Methyltransf_15; RNA cap guanine-N2 methyltransferase (PF09445; HMM-score: 14.9)Anamorsin_N; Anamorsin, N-terminal (PF20922; HMM-score: 14.5)Methyltr_RsmB-F; 16S rRNA methyltransferase RsmB/F (PF01189; HMM-score: 14.4)Methyltransf_29; Putative S-adenosyl-L-methionine-dependent methyltransferase (PF03141; HMM-score: 12.1)Fibrillarin; Fibrillarin (PF01269; HMM-score: 11.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.46
- Cytoplasmic Membrane Score: 0.5206
- Cell wall & surface Score: 0
- Extracellular Score: 0.0194
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.061569
- TAT(Tat/SPI): 0.000665
- LIPO(Sec/SPII): 0.000878
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MADNKANKEQVHRVFQNISKKYDRLNNIISFEQHKVWRKRVMKDMGVRKGTKALDVCCGTGDWTIALSKAVGPTGEVTGIDFSENMLEVGKEKTASMENVKLVHGDAMELPFEDNSFDYVTIGFGLRNVPDYLVALKEMNRVLKPGGMVVCLETSQPTLPVFKQMYALYFKFVMPIFGKLFAKSKEEYEWLQQSTFNFPGKEELKRMFEEAGFINVRVRSFTGGVAAMHLGYKEKDNTKGD
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
SA0033 (aadD) kanamycin nucleotidyltransferase [1] (data from MRSA252) SA1533 (ackA) acetate kinase [1] (data from MRSA252) SA0562 (adh1) alcohol dehydrogenase [1] (data from MRSA252) SA0366 (ahpC) alkyl hydroperoxide reductase [1] (data from MRSA252) SA2428 (arcA) arginine deiminase [1] (data from MRSA252) SA2427 (arcB) ornithine carbamoyltransferase [1] (data from MRSA252) SA1287 (asnC) asparaginyl-tRNA synthetase [1] (data from MRSA252) SA1984 (asp23) alkaline shock protein 23 [1] (data from MRSA252) SA1517 (citC) isocitrate dehydrogenase [1] (data from MRSA252) SA1498 (clpX) ATP-dependent protease ATP-binding subunit ClpX [1] (data from MRSA252) SA0471 (cysK) hypothetical protein [1] (data from MRSA252) SA1409 (dnaK) molecular chaperone DnaK [1] (data from MRSA252) SA0133 (dra) deoxyribose-phosphate aldolase [1] (data from MRSA252) SA0731 (eno) phosphopyruvate hydratase [1] (data from MRSA252) SA0545 (eutD) phosphotransacetylase [1] (data from MRSA252) SA1074 (fabG) 3-oxoacyl-ACP reductase [1] (data from MRSA252) SA1927 (fbaA) fructose-bisphosphate aldolase [1] (data from MRSA252) SA1553 (fhs) formate--tetrahydrofolate ligase [1] (data from MRSA252) SA1102 (frr) ribosome recycling factor [1] (data from MRSA252) SA1029 (ftsZ) cell division protein FtsZ [1] (data from MRSA252) SA0505 (fus) elongation factor G [1] (data from MRSA252) SA0727 (gap) glyceraldehyde-3-phosphate dehydrogenase [1] (data from MRSA252) SA1510 (gapB) glyceraldehyde 3-phosphate dehydrogenase 2 [1] (data from MRSA252) SA1717 (gatC) aspartyl/glutamyl-tRNA amidotransferase subunit C [1] (data from MRSA252) SA1959 (glmS) glucosamine--fructose-6-phosphate aminotransferase [1] (data from MRSA252) SA1150 (glnA) glutamine-ammonia ligase [1] (data from MRSA252) SA1836 (groEL) molecular chaperone GroEL [1] (data from MRSA252) SA1837 (groES) co-chaperonin GroES [1] (data from MRSA252) SA0375 (guaB) inositol-monophosphate dehydrogenase [1] (data from MRSA252) SA0819 (gudB) NAD-specific glutamate dehydrogenase [1] (data from MRSA252) SA1112 (infB) translation initiation factor IF-2 [1] (data from MRSA252) SA0245 (ispD) 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [1] (data from MRSA252) SA0232 (lctE) L-lactate dehydrogenase [1] (data from MRSA252) SA2400 (mqo2) malate:quinone oxidoreductase [1] (data from MRSA252) SA1926 (murZ) UDP-N-acetylglucosamine 1-carboxyvinyltransferase [1] (data from MRSA252) SA0943-1 (pdhA) pyruvate dehydrogenase E1 component subunit alpha [1] (data from MRSA252) SA0944 (pdhB) pyruvate dehydrogenase E1 component subunit beta [1] (data from MRSA252) SA0945 (pdhC) branched-chain alpha-keto acid dehydrogenase E2 subunit [1] (data from MRSA252) SA0946 (pdhD) dihydrolipoamide dehydrogenase [1] (data from MRSA252) SA1521 (pfkA) 6-phosphofructokinase [1] (data from MRSA252) SA0218 (pflB) formate acetyltransferase [1] (data from MRSA252) SA0728 (pgk) phosphoglycerate kinase [1] (data from MRSA252) SA1117 (pnpA) polynucleotide phosphorylase [1] (data from MRSA252) SA1520 (pykA) pyruvate kinase [1] (data from MRSA252) SA2341 (rocA) 1-pyrroline-5-carboxylate dehydrogenase [1] (data from MRSA252) SA0496 (rplA) 50S ribosomal protein L1 [1] (data from MRSA252) SA2047 (rplC) 50S ribosomal protein L3 [1] (data from MRSA252) SA2046 (rplD) 50S ribosomal protein L4 [1] (data from MRSA252) SA2035 (rplE) 50S ribosomal protein L5 [1] (data from MRSA252) SA0497 (rplJ) 50S ribosomal protein L10 [1] (data from MRSA252) SA0495 (rplK) 50S ribosomal protein L11 [1] (data from MRSA252) SA0498 (rplL) 50S ribosomal protein L7/L12 [1] (data from MRSA252) SA2029 (rplO) 50S ribosomal protein L15 [1] (data from MRSA252) SA2032 (rplR) 50S ribosomal protein L18 [1] (data from MRSA252) SA1084 (rplS) 50S ribosomal protein L19 [1] (data from MRSA252) SA1473 (rplU) 50S ribosomal protein L21 [1] (data from MRSA252) SA2042 (rplV) 50S ribosomal protein L22 [1] (data from MRSA252) SA2036 (rplX) 50S ribosomal protein L24 [1] (data from MRSA252) SA0459 (rplY) 50S ribosomal protein L25 [1] (data from MRSA252) SA1471 (rpmA) 50S ribosomal protein L27 [1] (data from MRSA252) SA2023 (rpoA) DNA-directed RNA polymerase subunit alpha [1] (data from MRSA252) SA0500 (rpoB) DNA-directed RNA polymerase subunit beta [1] (data from MRSA252) SA0501 (rpoC) DNA-directed RNA polymerase subunit beta' [1] (data from MRSA252) SA1930 (rpoE) DNA-directed RNA polymerase subunit delta [1] (data from MRSA252) SA2041 (rpsC) 30S ribosomal protein S3 [1] (data from MRSA252) SAS052 (rpsD) 30S ribosomal protein S4 [1] (data from MRSA252) SA2034 (rpsH) 30S ribosomal protein S8 [1] (data from MRSA252) SA2016 (rpsI) 30S ribosomal protein S9 [1] (data from MRSA252) SA2048 (rpsJ) 30S ribosomal protein S10 [1] (data from MRSA252) SA0009 (serS) seryl-tRNA synthetase [1] (data from MRSA252) SA0107 (spa) immunoglobulin G binding protein A [1] (data from MRSA252) SA1088 (sucC) succinyl-CoA synthetase subunit beta [1] (data from MRSA252) SA1506 (thrS) threonyl-tRNA synthetase [1] (data from MRSA252) SA1499 (tig) trigger factor [1] (data from MRSA252) SA0729 (tpiA) triosephosphate isomerase [1] (data from MRSA252) SA0992 (trxA) thioredoxin [1] (data from MRSA252) SA1100 (tsf) elongation factor Ts [1] (data from MRSA252) SA0506 (tuf) elongation factor Tu [1] (data from MRSA252) SA1914 (upp) uracil phosphoribosyltransferase [1] (data from MRSA252) SA0295 hypothetical protein [1] (data from MRSA252) SA0372 hypothetical protein [1] (data from MRSA252) SA0707 hypothetical protein [1] (data from MRSA252) SA0873 hypothetical protein [1] (data from MRSA252) SA1255 PTS system glucose-specific transporter subunit enzyme II A [1] (data from MRSA252) SA1359 elongation factor P [1] (data from MRSA252) SA1571 D-alanine aminotransferase [1] (data from MRSA252) SA1572 dipeptidase PepV [1] (data from MRSA252) SA2399 fructose-1,6-bisphosphate aldolase [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: ndk < gerCC < ubiE < SA1304
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 1.45 1.46 1.47 1.48 1.49 1.50 1.51 1.52 1.53 1.54 1.55 1.56 1.57 1.58 1.59 1.60 1.61 1.62 1.63 1.64 1.65 1.66 1.67 1.68 1.69 1.70 1.71 1.72 1.73 1.74 1.75 1.76 1.77 1.78 1.79 1.80 1.81 1.82 1.83 1.84 1.85 1.86 1.87 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)