From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01487
  • pan locus tag?: SAUPAN003931000
  • symbol: ubiE
  • pan gene symbol?: ubiE
  • synonym:
  • product: ubiquinone/menaquinone biosynthesis methyltransferase

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_01487
  • symbol: ubiE
  • product: ubiquinone/menaquinone biosynthesis methyltransferase
  • replicon: chromosome
  • strand: -
  • coordinates: 1443873..1444475
  • length: 603
  • essential: no [1] DEG other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGAAAGACATGGGTGTTAGAAAAGGGACGAAAGCATTAGATGTTTGTTGTGGTACTGGT
    GATTGGACAATCGCATTAAGCAAAGCTGTAGGACCAACAGGTGAAGTTACTGGTATTGAC
    TTTAGTGAGAATATGTTAGAAGTAGGAAAAGAAAAAACTGCTTCAATGGAAAATGTTAAA
    CTTGTTCATGGTGATGCAATGGAATTGCCGTTTGAAGACAATTCTTTTGATTATGTAACA
    ATTGGGTTTGGATTAAGAAATGTGCCAGACTATTTAGTCGCGTTAAAAGAAATGAATAGA
    GTACTTAAACCAGGTGGTATGGTGGTATGTCTTGAAACGAGCCAACCAACTTTGCCAGTC
    TTTAAACAAATGTATGCACTATACTTTAAATTTGTTATGCCTATTTTTGGAAAATTATTT
    GCAAAATCAAAAGAAGAATATGAATGGTTACAGCAATCTACGTTTAATTTTCCTGGAAAA
    GAAGAGTTGAAGCGCATGTTTGAAGAAGCAGGTTTCATAAATGTAAGAGTACGTAGTTTT
    ACAGGGGGCGTTGCTGCAATGCACCTTGGCTATAAAGAAAAAGATAATACCAAAGGTGAT
    TAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    603

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAOUHSC_01487
  • symbol: UbiE
  • description: ubiquinone/menaquinone biosynthesis methyltransferase
  • length: 200
  • theoretical pI: 5.87366
  • theoretical MW: 22370.8
  • GRAVY: -0.2145

⊟Function[edit | edit source]

  • reaction:
    EC 2.1.1.-?  ExPASy
  • TIGRFAM:
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone demethylmenaquinone methyltransferase (TIGR02752; EC 2.1.1.163; HMM-score: 342.7)
    and 22 more
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone ubiquinone/menaquinone biosynthesis methyltransferase (TIGR01934; EC 2.1.1.-; HMM-score: 246.1)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Biotin malonyl-acyl carrier protein O-methyltransferase BioC (TIGR02072; EC 2.1.1.-; HMM-score: 62.1)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit (TIGR02469; EC 2.1.1.132; HMM-score: 39.4)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Glutathione and analogs putative 4-mercaptohistidine N1-methyltranferase (TIGR04345; HMM-score: 34.1)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone 3-demethylubiquinone-9 3-O-methyltransferase (TIGR01983; EC 2.1.1.64; HMM-score: 33.9)
    Genetic information processing Protein fate Protein modification and repair protein-(glutamine-N5) methyltransferase, release factor-specific (TIGR03534; EC 2.1.1.-; HMM-score: 31.3)
    Unknown function Enzymes of unknown specificity tRNA (cmo5U34)-methyltransferase (TIGR00740; EC 2.1.1.-; HMM-score: 28.7)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Chlorophyll and bacteriochlorphyll magnesium protoporphyrin O-methyltransferase (TIGR02021; EC 2.1.1.11; HMM-score: 27.3)
    methyltransferase, FxLD system (TIGR04364; HMM-score: 27.2)
    Genetic information processing Protein fate Protein modification and repair protein-L-isoaspartate O-methyltransferase (TIGR00080; EC 2.1.1.77; HMM-score: 26.6)
    Metabolism Amino acid biosynthesis Aspartate family methionine biosynthesis protein MetW (TIGR02081; HMM-score: 23.8)
    Genetic information processing Protein fate Protein modification and repair methyltransferase, HemK family (TIGR00536; HMM-score: 21.4)
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific (TIGR03533; EC 2.1.1.-; HMM-score: 20.4)
    Genetic information processing Protein synthesis tRNA and rRNA base modification ribosomal RNA small subunit methyltransferase A (TIGR00755; EC 2.1.1.182; HMM-score: 19.2)
    Genetic information processing Protein synthesis tRNA and rRNA base modification ribosomal RNA large subunit methyltransferase J (TIGR00438; EC 2.1.1.166; HMM-score: 16.6)
    Genetic information processing Protein synthesis tRNA and rRNA base modification tRNA (guanine-N(7)-)-methyltransferase (TIGR00091; EC 2.1.1.33; HMM-score: 15.6)
    Genetic information processing Protein synthesis tRNA and rRNA base modification 23S rRNA (uracil-5-)-methyltransferase RumA (TIGR00479; EC 2.1.1.-; HMM-score: 12.7)
    Hypothetical proteins Conserved putative methyltransferase, TIGR01177 family (TIGR01177; HMM-score: 12.7)
    methyltransferase, ATP-grasp peptide maturase system (TIGR04188; HMM-score: 12.4)
    methyltransferase, Rta_06860 family (TIGR04290; EC 2.1.1.-; HMM-score: 12.1)
    2-ketoarginine methyltransferase (TIGR04543; EC 2.1.1.243; HMM-score: 11.9)
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific (TIGR03704; EC 2.1.1.-; HMM-score: 11.5)
  • TheSEED  :
    • 2-heptaprenyl-1,4-naphthoquinone methyltransferase (EC 2.1.1.163)
    • 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase (EC 2.1.1.201)
    Cofactors, Vitamins, Prosthetic Groups, Pigments Quinone cofactors Menaquinone and Phylloquinone Biosynthesis  Ubiquinone/menaquinone biosynthesis methyltransferase UbiE (EC 2.1.1.-)
    and 1 more
    Cofactors, Vitamins, Prosthetic Groups, Pigments Quinone cofactors Menaquinone biosynthesis from chorismate via 1,4-dihydroxy-2-naphthoate  2-heptaprenyl-1,4-naphthoquinone methyltransferase MenG (EC 2.1.1.163)
  • PFAM:
    NADP_Rossmann (CL0063) Ubie_methyltran; ubiE/COQ5 methyltransferase family (PF01209; HMM-score: 266.4)
    and 24 more
    Methyltransf_25; Methyltransferase domain (PF13649; HMM-score: 93.8)
    Methyltransf_11; Methyltransferase domain (PF08241; HMM-score: 86.1)
    Methyltransf_31; Methyltransferase domain (PF13847; HMM-score: 81.1)
    Methyltransf_23; Methyltransferase domain (PF13489; HMM-score: 64)
    Methyltransf_12; Methyltransferase domain (PF08242; HMM-score: 56.9)
    PCMT; Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) (PF01135; HMM-score: 39.2)
    FtsJ; FtsJ-like methyltransferase (PF01728; HMM-score: 30.7)
    Methyltransf_4; Putative methyltransferase (PF02390; HMM-score: 29.2)
    MTS; Methyltransferase small domain (PF05175; HMM-score: 21.6)
    Methyltransf_8; Hypothetical methyltransferase (PF05148; HMM-score: 20.7)
    MetW; Methionine biosynthesis protein MetW (PF07021; HMM-score: 20.7)
    GCD14; tRNA methyltransferase complex GCD14 subunit (PF08704; HMM-score: 19.7)
    Methyltransf_24; Methyltransferase domain (PF13578; HMM-score: 19.6)
    CMAS; Mycolic acid cyclopropane synthetase (PF02353; HMM-score: 18.7)
    Rsm22; Mitochondrial small ribosomal subunit Rsm22 (PF09243; HMM-score: 17.7)
    Methyltransf_15; RNA cap guanine-N2 methyltransferase (PF09445; HMM-score: 14.9)
    Methyltr_RsmB-F; 16S rRNA methyltransferase RsmB/F (PF01189; HMM-score: 14.8)
    RrnaAD; Ribosomal RNA adenine dimethylase (PF00398; HMM-score: 14.3)
    Methyltransf_18; Methyltransferase domain (PF12847; HMM-score: 14)
    ADH_zinc_N; Zinc-binding dehydrogenase (PF00107; HMM-score: 13.4)
    NodS; Nodulation protein S (NodS) (PF05401; HMM-score: 13.1)
    Methyltransf_3; O-methyltransferase (PF01596; HMM-score: 12.3)
    Methyltransf_29; Putative S-adenosyl-L-methionine-dependent methyltransferase (PF03141; HMM-score: 11.7)
    PrmA; Ribosomal protein L11 methyltransferase (PrmA) (PF06325; HMM-score: 11.2)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.027387
    • TAT(Tat/SPI): 0.001134
    • LIPO(Sec/SPII): 0.006021
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MKDMGVRKGTKALDVCCGTGDWTIALSKAVGPTGEVTGIDFSENMLEVGKEKTASMENVKLVHGDAMELPFEDNSFDYVTIGFGLRNVPDYLVALKEMNRVLKPGGMVVCLETSQPTLPVFKQMYALYFKFVMPIFGKLFAKSKEEYEWLQQSTFNFPGKEELKRMFEEAGFINVRVRSFTGGVAAMHLGYKEKDNTKGD

⊟Experimental data[edit | edit source]

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Roy R Chaudhuri, Andrew G Allen, Paul J Owen, Gil Shalom, Karl Stone, Marcus Harrison, Timothy A Burgis, Michael Lockyer, Jorge Garcia-Lara, Simon J Foster, Stephen J Pleasance, Sarah E Peters, Duncan J Maskell, Ian G Charles
    Comprehensive identification of essential Staphylococcus aureus genes using Transposon-Mediated Differential Hybridisation (TMDH).
    BMC Genomics: 2009, 10;291
    [PubMed:19570206] [WorldCat.org] [DOI] (I e)
  2. ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  3. ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  4. ↑ 4.00 4.01 4.02 4.03 4.04 4.05 4.06 4.07 4.08 4.09 4.10 4.11 4.12 4.13 4.14 4.15 4.16 4.17 4.18 4.19 4.20 4.21 4.22 4.23 4.24 4.25 4.26 4.27 4.28 4.29 4.30 4.31 4.32 4.33 4.34 4.35 4.36 4.37 4.38 4.39 4.40 4.41 4.42 4.43 4.44 4.45 4.46 4.47 4.48 4.49 4.50 4.51 4.52 4.53 4.54 4.55 4.56 4.57 4.58 4.59 4.60 4.61 4.62 4.63 4.64 4.65 4.66 4.67 4.68 4.69 4.70 4.71 4.72 4.73 4.74 4.75 4.76 4.77 4.78 4.79 4.80 4.81 4.82 4.83 4.84 4.85 4.86 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)
  5. ↑ 5.0 5.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SAOUHSC_01487&oldid=82142"