Jump to navigation
Jump to search
COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 23-MAY-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_pUSA030012 [new locus tag: SAUSA300_RS14795 ]
- pan locus tag?:
- symbol: traC
- pan gene symbol?: —
- synonym:
- product: membrane protein TraC
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_pUSA030012 [new locus tag: SAUSA300_RS14795 ]
- symbol: traC
- product: membrane protein TraC
- replicon: pUSA03
- strand: +
- coordinates: 11407..11814
- length: 408
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID: 3912752 NCBI
- RefSeq: YP_492698 NCBI
- BioCyc: see SAUSA300_RS14795
- MicrobesOnline: 1291491 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGTCTGTTGAGCAAGAAGTTAAAGATATAATGCTCGATATGTTGGGCGAAGAAAAGAAA
GTTAAAGAGAATATAATACCTCGTAATGTAGACGCTAGTTATAAAATATTCTTAAATTTA
AACGGTAAAGAATTAGCAATTGTATTTGTTCCTTTTTTACTATTTCTAACAATAGCATTT
GGTGTAACGTTTTTAATGGGCTTACTTAATTTAATAACTGGCTTTATGGTTTTTATAGTA
GGTTTGATTTTTGGTTTAACAATATATGGCTTACTAACAATTAGACCAATTAGTACAAAA
GAAAATATAAGAATGATTGATACCATAAAACAATCACAACGATTTAGCAGAAGGCAGAAA
GTTTACTTCTATAAAAGTAAAGAAGGATTGGGTGATGATGATGTTTAA60
120
180
240
300
360
408
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_pUSA030012 [new locus tag: SAUSA300_RS14795 ]
- symbol: TraC
- description: membrane protein TraC
- length: 135
- theoretical pI: 9.41803
- theoretical MW: 15476.3
- GRAVY: 0.331852
⊟Function[edit | edit source]
- TIGRFAM: Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides intracellular adhesion protein D (TIGR03932; HMM-score: 11.2)
- TheSEED :
- putative membrane protein TraC
- PFAM: no clan defined PrgI; PrgI family protein (PF12666; HMM-score: 19.1)and 9 morePhage_holin_3_6; Putative Actinobacterial Holin-X, holin superfamily III (PF07332; HMM-score: 15)YwcE; Spore morphogenesis and germination protein YwcE (PF17368; HMM-score: 14.3)DUF2207; Predicted membrane protein (DUF2207) (PF09972; HMM-score: 13.7)DUF2149; Uncharacterized conserved protein (DUF2149) (PF09919; HMM-score: 13)Myc_target_1; Myc target protein 1 (PF15179; HMM-score: 12.4)YuiB; Putative membrane protein (PF14068; HMM-score: 9.6)APC (CL0062) AA_permease_C; C-terminus of AA_permease (PF13906; HMM-score: 9.4)no clan defined Promethin; Promethin (PF16015; HMM-score: 7.3)DUF5469; Family of unknown function (DUF5469) (PF17561; HMM-score: 7.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004948
- TAT(Tat/SPI): 0.000137
- LIPO(Sec/SPII): 0.002723
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSVEQEVKDIMLDMLGEEKKVKENIIPRNVDASYKIFLNLNGKELAIVFVPFLLFLTIAFGVTFLMGLLNLITGFMVFIVGLIFGLTIYGLLTIRPISTKENIRMIDTIKQSQRFSRRQKVYFYKSKEGLGDDDV
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.