From AureoWiki
Jump to navigation Jump to search
COLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 23-MAY-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_pUSA030012 [new locus tag: SAUSA300_RS14795 ]
  • pan locus tag?:
  • symbol: traC
  • pan gene symbol?:
  • synonym:
  • product: membrane protein TraC

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_pUSA030012 [new locus tag: SAUSA300_RS14795 ]
  • symbol: traC
  • product: membrane protein TraC
  • replicon: pUSA03
  • strand: +
  • coordinates: 11407..11814
  • length: 408
  • essential: unknown

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGTCTGTTGAGCAAGAAGTTAAAGATATAATGCTCGATATGTTGGGCGAAGAAAAGAAA
    GTTAAAGAGAATATAATACCTCGTAATGTAGACGCTAGTTATAAAATATTCTTAAATTTA
    AACGGTAAAGAATTAGCAATTGTATTTGTTCCTTTTTTACTATTTCTAACAATAGCATTT
    GGTGTAACGTTTTTAATGGGCTTACTTAATTTAATAACTGGCTTTATGGTTTTTATAGTA
    GGTTTGATTTTTGGTTTAACAATATATGGCTTACTAACAATTAGACCAATTAGTACAAAA
    GAAAATATAAGAATGATTGATACCATAAAACAATCACAACGATTTAGCAGAAGGCAGAAA
    GTTTACTTCTATAAAAGTAAAGAAGGATTGGGTGATGATGATGTTTAA
    60
    120
    180
    240
    300
    360
    408


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_pUSA030012 [new locus tag: SAUSA300_RS14795 ]
  • symbol: TraC
  • description: membrane protein TraC
  • length: 135
  • theoretical pI: 9.41803
  • theoretical MW: 15476.3
  • GRAVY: 0.331852

Function[edit | edit source]

  • TIGRFAM:
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides intracellular adhesion protein D (TIGR03932; HMM-score: 11.2)
  • TheSEED  :
    • putative membrane protein TraC
  • PFAM:
    no clan defined PrgI; PrgI family protein (PF12666; HMM-score: 19.9)
    and 7 more
    DUF2149; Uncharacterized conserved protein (DUF2149) (PF09919; HMM-score: 13.1)
    DUF2207_C; Predicted membrane protein (DUF2207) C-terminal domain (PF20990; HMM-score: 13)
    Phage_holin_3_6; Putative Actinobacterial Holin-X, holin superfamily III (PF07332; HMM-score: 12.2)
    Myc_target_1; Myc target protein 1 (PF15179; HMM-score: 10.4)
    DUF3671; Fam-L, Fam-M like protein (PF12420; HMM-score: 9.8)
    APC (CL0062) AA_permease_C; C-terminus of AA_permease (PF13906; HMM-score: 9.5)
    no clan defined Promethin; Promethin (PF16015; HMM-score: 8.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0001
    • Cytoplasmic Membrane Score: 0.9977
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0022
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004948
    • TAT(Tat/SPI): 0.000137
    • LIPO(Sec/SPII): 0.002723
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MSVEQEVKDIMLDMLGEEKKVKENIIPRNVDASYKIFLNLNGKELAIVFVPFLLFLTIAFGVTFLMGLLNLITGFMVFIVGLIFGLTIYGLLTIRPISTKENIRMIDTIKQSQRFSRRQKVYFYKSKEGLGDDDV

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]