From AureoWiki
Jump to navigation Jump to search
COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 23-MAY-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_pUSA030017 [new locus tag: SAUSA300_RS14820 ]
  • pan locus tag?:
  • symbol: traH
  • pan gene symbol?:
  • synonym:
  • product: transfer complex protein TraH

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_pUSA030017 [new locus tag: SAUSA300_RS14820 ]
  • symbol: traH
  • product: transfer complex protein TraH
  • replicon: pUSA03
  • strand: +
  • coordinates: 16913..17398
  • length: 486
  • essential: unknown

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGAAAAAATTATTAACTATAGTTATTTTATTCACTTTGGTTCTGGCTGGTTGTGGCCAA
    AATCAAAGTGAGAAAAATAGTGAAAAACATAATGAAGAAAAAACAGTAGATACTACAGAA
    GAAAGAAACGATATGATAAAAGGTCTAATTGAATATGGTTATGAAAATGATGATTATAAA
    GGTTATAAGCATATGAAAGATATATTATCTGAAAAGTTGCAAAAGCAAGCAGAATTGCAA
    AATCAATCAGCACAAACTAAAGGTGTAAAAAAAGAAACTAAAGACATTAAACTTTATCAA
    GACGTAGATAATGATGATGAATTGATTTATTCTATTAAACTTTCAATTACAAACAAAAAA
    GAGAAAAACTCTGACTACTCAATGAGATATGGGAAAATTGAATTAACGGAAGAAGAAGGT
    AAACAAAAGATAGATAATGTCGAAGAACTAACACAAAGAAATTTAGTAAGTATGAATCAA
    GAATAG
    60
    120
    180
    240
    300
    360
    420
    480
    486

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_pUSA030017 [new locus tag: SAUSA300_RS14820 ]
  • symbol: TraH
  • description: transfer complex protein TraH
  • length: 161
  • theoretical pI: 4.87837
  • theoretical MW: 18763
  • GRAVY: -1.0795

Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Sporulation and germination sporulation lipoprotein, YhcN/YlaJ family (TIGR02898; HMM-score: 17)
    Cell structure Cell envelope Other uncharacterized lipoprotein (TIGR02722; HMM-score: 15.6)
    and 1 more
    extracellular lipase, Pla-1/cef family (TIGR03502; EC 3.1.-.-; HMM-score: 11.3)
  • TheSEED:  
    FIG01110541: hypothetical protein
  • PFAM:
    LppaM (CL0421) LPAM_2; Prokaryotic lipoprotein-attachment site (PF13627; HMM-score: 12.6)
    and 1 more
    FtsL (CL0225) DivIC; Septum formation initiator (PF04977; HMM-score: 7.8)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helices: 0
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0
    • Signal peptide possibility: 0.5
    • N-terminally Anchored Score: 2
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: Signal peptide LIPO(Sec/SPII) length 17 aa
    • SP(Sec/SPI): 0.000372
    • TAT(Tat/SPI): 0.000083
    • LIPO(Sec/SPII): 0.99931
    • Cleavage Site: CS pos: 17-18. LAG-CG. Pr: 0.9999
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKKLLTIVILFTLVLAGCGQNQSEKNSEKHNEEKTVDTTEERNDMIKGLIEYGYENDDYKGYKHMKDILSEKLQKQAELQNQSAQTKGVKKETKDIKLYQDVDNDDELIYSIKLSITNKKEKNSDYSMRYGKIELTEEEGKQKIDNVEELTQRNLVSMNQE

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]