From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1144 [new locus tag: SA_RS06460 ]
  • pan locus tag?: SAUPAN003618000
  • symbol: miaA
  • pan gene symbol?: miaA
  • synonym:
  • product: tRNA delta(2)-isopentenylpyrophosphate transferase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1144 [new locus tag: SA_RS06460 ]
  • symbol: miaA
  • product: tRNA delta(2)-isopentenylpyrophosphate transferase
  • replicon: chromosome
  • strand: +
  • coordinates: 1302047..1302982
  • length: 936
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    ATGAATAAAAATAAGCCTTTTATTGTAGTAATTGTGGGGCCAACTGCTTCAGGTAAAACA
    GAGCTTAGCATAGAACTCGCGAAGCGTATCAATGGTGAAATCATAAGCGGTGATTCTATG
    CAAGTTTACAAACATATGAATATTGGAACTGCAAAAGTAACACCTGAAGAAATGGATGGT
    ATTCCACATCATTTAATTGATATCTTGAATCCTGATGATACATTTTCAGCATATGAATTC
    AAGCGATTAGCAGAAGATTTAATTACTGATATAACGAATAGAGGTAAAGTTCCAATCATA
    GCAGGTGGAACAGGCTTATATATTCAATCATTAATATATAATTATGAATTAGAAGATGAA
    ACAGTTACACCTGCACAATTATCCATAGTTAAACAAAAGTTATCTGCATTAGAACATTTA
    GATAATCAGCAACTACACGATTATTTAGCTCAATTTGATGCGGTTTCTGCAGAAAATATT
    CACCCTAACAACCGCCAAAGAGTGTTGCGCGCTATTGAATATTATTTAAAAACAAAAAAA
    CTTTTGAGTAATCGCAAGAAAGTGCAACAATTTACTGAAAATTATGATACATTATTATTA
    GGGATTGAAATGTCGCGTAAAACATTATATTCAAGAATAAATAAACGTGTTGATATTATG
    TTGGATCACGGATTATTTAGAGAAGTGCAACAACTTGTTGAACAAGGCTATGAATCTTGC
    CAAAGTATGCAAGCTATTGGATATAAAGAATTAATACCTGTGATTAACGGACAAATGATT
    TATGAAGATGCTGTCAATGATTTAAAGCAACATTCACGCCAATATGCAAAACGACAAATG
    ACATGGTTCAAGAATAAAATGAGTGTTCATTGGTTAGATAAAGAAAATATGTCACTTCAA
    ATGATGTTAGATGAGATTACAACCCAGATTAAGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    936

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1144 [new locus tag: SA_RS06460 ]
  • symbol: MiaA
  • description: tRNA delta(2)-isopentenylpyrophosphate transferase
  • length: 311
  • theoretical pI: 6.80558
  • theoretical MW: 35868
  • GRAVY: -0.431833

Function[edit source | edit]

  • reaction:
    EC 2.5.1.75?  ExPASy
    tRNA dimethylallyltransferaseDimethylallyl diphosphate + adenine37 in tRNA = diphosphate + N6-dimethylallyladenine37 in tRNA
  • TIGRFAM:
    Genetic information processingProtein synthesistRNA and rRNA base modificationtRNA dimethylallyltransferase (TIGR00174; EC 2.5.1.75; HMM-score: 324.5)
    carbohydrate kinase, thermoresistant glucokinase family (TIGR01313; EC 2.7.1.-; HMM-score: 15.3)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesNucleotide and nucleoside interconversionscytidylate kinase (TIGR00017; EC 2.7.4.14; HMM-score: 13.4)
    putative cytidylate kinase (TIGR02173; EC 2.7.4.14; HMM-score: 13.2)
    MetabolismCentral intermediary metabolismOther2,4-diaminobutyrate 4-transaminase (TIGR00709; EC 2.6.1.-; HMM-score: 10.8)
  • TheSEED:  
    RNA MetabolismRNA processing and modificationtRNA processing tRNA dimethylallyltransferase (EC 2.5.1.75) 
  • PFAM:
    P-loop_NTPase (CL0023) IPPT; IPP transferase (PF01715; HMM-score: 267.1)
    IPT; Isopentenyl transferase (PF01745; HMM-score: 34.6)
    AAA_33; AAA domain (PF13671; HMM-score: 21.1)
    AAA_18; AAA domain (PF13238; HMM-score: 16.1)
    Zeta_toxin; Zeta toxin (PF06414; HMM-score: 14.5)
    Cytidylate_kin; Cytidylate kinase (PF02224; HMM-score: 14.3)
    RNA_helicase; RNA helicase (PF00910; HMM-score: 14.3)
    Hydin_ADK; Hydin Adenylate kinase-like domain (PF17213; HMM-score: 13.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Mg2+
  • effectors:
  • protein partners:
    SA0905(atl)autolysin, N-acetylmuramyl-L-alanine amidase and endo-b-N-acetylglucosaminidas  [1] (data from MRSA252)
    SA1905(atpD)ATP synthase F0F1 subunit beta  [1] (data from MRSA252)
    SA1517(citC)isocitrate dehydrogenase  [1] (data from MRSA252)
    SA2057(fmhB)FmhB protein  [1] (data from MRSA252)
    SA1029(ftsZ)cell division protein FtsZ  [1] (data from MRSA252)
    SA1510(gapB)glyceraldehyde 3-phosphate dehydrogenase 2  [1] (data from MRSA252)
    SA1305(hu)DNA-binding protein II  [1] (data from MRSA252)
    SA1112(infB)translation initiation factor IF-2  [1] (data from MRSA252)
    SA1504(infC)translation initiation factor IF-3  [1] (data from MRSA252)
    SA0038(mecA)penicillin binding protein 2 prime  [1] (data from MRSA252)
    SA1144(miaA)tRNA delta(2)-isopentenylpyrophosphate transferase  [1] (data from MRSA252)
    SA0943-1(pdhA)pyruvate dehydrogenase E1 component subunit alpha  [1] (data from MRSA252)
    SA0944(pdhB)pyruvate dehydrogenase E1 component subunit beta  [1] (data from MRSA252)
    SA0945(pdhC)branched-chain alpha-keto acid dehydrogenase E2 subunit  [1] (data from MRSA252)
    SA0946(pdhD)dihydrolipoamide dehydrogenase  [1] (data from MRSA252)
    SA1520(pykA)pyruvate kinase  [1] (data from MRSA252)
    SA1101(pyrH)uridylate kinase  [1] (data from MRSA252)
    SA1324(rluB)ribosomal large subunit pseudouridine synthase B  [1] (data from MRSA252)
    SA0496(rplA)50S ribosomal protein L1  [1] (data from MRSA252)
    SA2044(rplB)50S ribosomal protein L2  [1] (data from MRSA252)
    SA2047(rplC)50S ribosomal protein L3  [1] (data from MRSA252)
    SA2046(rplD)50S ribosomal protein L4  [1] (data from MRSA252)
    SA2035(rplE)50S ribosomal protein L5  [1] (data from MRSA252)
    SA2033(rplF)50S ribosomal protein L6  [1] (data from MRSA252)
    SA0497(rplJ)50S ribosomal protein L10  [1] (data from MRSA252)
    SA0495(rplK)50S ribosomal protein L11  [1] (data from MRSA252)
    SA0498(rplL)50S ribosomal protein L7/L12  [1] (data from MRSA252)
    SA2037(rplN)50S ribosomal protein L14  [1] (data from MRSA252)
    SA2029(rplO)50S ribosomal protein L15  [1] (data from MRSA252)
    SA2032(rplR)50S ribosomal protein L18  [1] (data from MRSA252)
    SA1084(rplS)50S ribosomal protein L19  [1] (data from MRSA252)
    SA1502(rplT)50S ribosomal protein L20  [1] (data from MRSA252)
    SA1473(rplU)50S ribosomal protein L21  [1] (data from MRSA252)
    SA2042(rplV)50S ribosomal protein L22  [1] (data from MRSA252)
    SA2045(rplW)50S ribosomal protein L23  [1] (data from MRSA252)
    SA2036(rplX)50S ribosomal protein L24  [1] (data from MRSA252)
    SA1471(rpmA)50S ribosomal protein L27  [1] (data from MRSA252)
    SA1067(rpmB)50S ribosomal protein L28  [1] (data from MRSA252)
    SA2039(rpmC)50S ribosomal protein L29  [1] (data from MRSA252)
    SA1922(rpmE2)50S ribosomal protein L31  [1] (data from MRSA252)
    SA1503(rpmI)50S ribosomal protein L35  [1] (data from MRSA252)
    SA2041(rpsC)30S ribosomal protein S3  [1] (data from MRSA252)
    SAS052(rpsD)30S ribosomal protein S4  [1] (data from MRSA252)
    SA2031(rpsE)30S ribosomal protein S5  [1] (data from MRSA252)
    SA0352(rpsF)30S ribosomal protein S6  [1] (data from MRSA252)
    SA0504(rpsG)30S ribosomal protein S7  [1] (data from MRSA252)
    SA2016(rpsI)30S ribosomal protein S9  [1] (data from MRSA252)
    SA2024(rpsK)30S ribosomal protein S11  [1] (data from MRSA252)
    SA0503(rpsL)30S ribosomal protein S12  [1] (data from MRSA252)
    SA2025(rpsM)30S ribosomal protein S13  [1] (data from MRSA252)
    SA1116(rpsO)30S ribosomal protein S15  [1] (data from MRSA252)
    SA2038(rpsQ)30S ribosomal protein S17  [1] (data from MRSA252)
    SA1245(sucA)2-oxoglutarate dehydrogenase E1  [1] (data from MRSA252)
    SA0506(tuf)elongation factor Tu  [1] (data from MRSA252)
    SA0295hypothetical protein  [1] (data from MRSA252)
    SA0490hypothetical protein  [1] (data from MRSA252)
    SA0637hypothetical protein  [1] (data from MRSA252)
    SA0663hypothetical protein  [1] (data from MRSA252)
    SA0802hypothetical protein  [1] (data from MRSA252)
    SA1118hypothetical protein  [1] (data from MRSA252)
    SA1223hypothetical protein  [1] (data from MRSA252)
    SA1387hypothetical protein  [1] (data from MRSA252)
    SA1423hypothetical protein  [1] (data from MRSA252)
    SA1528hypothetical protein  [1] (data from MRSA252)
    SA1559hypothetical protein  [1] (data from MRSA252)
    SA1560hypothetical protein  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 0.83
    • Signal Peptide Possibility: -0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.19
    • Ymax_pos: 11
    • Cmax: 0.168
    • Cmax_pos: 28
    • Smax: 0.474
    • Smax_pos: 1
    • Smean: 0.338
    • D: 0.247
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNKNKPFIVVIVGPTASGKTELSIELAKRINGEIISGDSMQVYKHMNIGTAKVTPEEMDGIPHHLIDILNPDDTFSAYEFKRLAEDLITDITNRGKVPIIAGGTGLYIQSLIYNYELEDETVTPAQLSIVKQKLSALEHLDNQQLHDYLAQFDAVSAENIHPNNRQRVLRAIEYYLKTKKLLSNRKKVQQFTENYDTLLLGIEMSRKTLYSRINKRVDIMLDHGLFREVQQLVEQGYESCQSMQAIGYKELIPVINGQMIYEDAVNDLKQHSRQYAKRQMTWFKNKMSVHWLDKENMSLQMMLDEITTQIK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 1.45 1.46 1.47 1.48 1.49 1.50 1.51 1.52 1.53 1.54 1.55 1.56 1.57 1.58 1.59 1.60 1.61 1.62 1.63 1.64 1.65

Relevant publications[edit source | edit]