From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1223 [new locus tag: SA_RS06950 ]
  • pan locus tag?: SAUPAN003803000
  • symbol: SA1223
  • pan gene symbol?: cvfB
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1223 [new locus tag: SA_RS06950 ]
  • symbol: SA1223
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1396031..1396933
  • length: 903
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    ATGGCATTAGACAAAGATATAGTAGGTTCTATAGAATTCCTTGAAGTAGTAGGGTTACAA
    GGCTCAACTTACCTTTTAAAAGGACCAAACGGTGAAAACGTAAAGTTAAACCAATCAGAA
    ATGAACGATGATGATGAATTAGAAGTAGGTGAAGAATATAGTTTCTTCATTTATCCAAAC
    CGTTCAGGTGAATTATTTGCAACTCAAAATATGCCTGATATTACGAAAGATAAATATGAT
    TTTGCTAAAGTACTTAAAACGGATCGCGATGGGGCACGTATAGATGTTGGTTTACCCCGT
    GAAGTGTTAGTACCATGGGAAGATTTACCAAAAGTGAAATCACTATGGCCACAACCTGGT
    GATCATTTGCTAGTTACATTACGAATTGACCGTGAGAATCATATGTATGGACGTTTAGCG
    AGTGAATCTGTTGTAGAAAATATGTTTACACCTGTACACGATGATAATTTAAAAAACGAA
    GTCATTGAAGCCAAACCTTACCGCGTATTACGAATTGGTAGCTTCTTATTAAGCGAATCA
    GGTTACAAAATTTTCGTACATGAATCAGAACGTAAAGCTGAACCAAGATTAGGTGAATCT
    GTTCAAGTTAGAATTATCGGGCATAATGATAAAGGTGAGTTAAATGGTTCATTTTTACCA
    CTTGCACATGAACGTTTAGACGATGACGGCCAAGTCATCTTTGATTTACTAGTTGAATAT
    GATGGTGAATTACCATTCTGGGACAAATCAAGCCCTGAAGCGATTAAAGAAGTATTCAAT
    ATGAGTAAAGGTTCATTCAAACGTGCAATCGGTCACTTATATAAACAGAAGATTATTAAT
    ATAGAAACAGGTAAAATCACTTTAACTAAAAAAGGTTGGAGTCGAATTGACTCAAAAGAA
    TAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    903

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1223 [new locus tag: SA_RS06950 ]
  • symbol: SA1223
  • description: hypothetical protein
  • length: 300
  • theoretical pI: 4.82893
  • theoretical MW: 34184.5
  • GRAVY: -0.500667

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    Uncharacterized S1 RNA binding domain protein YitL 
  • PFAM:
    OB (CL0021) S1_2; S1 domain (PF13509; HMM-score: 36.8)
    S1; S1 RNA binding domain (PF00575; HMM-score: 19.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    SA0033(aadD)kanamycin nucleotidyltransferase  [1] (data from MRSA252)
    SA1075(acpP)acyl carrier protein  [1] (data from MRSA252)
    SA2027(adk)adenylate kinase  [1] (data from MRSA252)
    SA2428(arcA)arginine deiminase  [1] (data from MRSA252)
    SA0564(argS)arginyl-tRNA synthetase  [1] (data from MRSA252)
    SA1905(atpD)ATP synthase F0F1 subunit beta  [1] (data from MRSA252)
    SA1046(carB)carbamoyl phosphate synthase large subunit  [1] (data from MRSA252)
    SA1557(ccpA)catabolite control protein A  [1] (data from MRSA252)
    SA1309(cmk)cytidylate kinase  [1] (data from MRSA252)
    SA0471(cysK)hypothetical protein  [1] (data from MRSA252)
    SA1887(ddl)D-alanyl-alanine synthetase A  [1] (data from MRSA252)
    SA1073(fabD)malonyl CoA-ACP transacylase  [1] (data from MRSA252)
    SA0842(FabH)3-oxoacyl-ACP synthase  [1] (data from MRSA252)
    SA0869(fabI)enoyl-ACP reductase  [1] (data from MRSA252)
    SA1901(fabZ)(3R)-hydroxymyristoyl-ACP dehydratase  [1] (data from MRSA252)
    SA1553(fhs)formate--tetrahydrofolate ligase  [1] (data from MRSA252)
    SA1102(frr)ribosome recycling factor  [1] (data from MRSA252)
    SA1028(ftsA)cell division protein  [1] (data from MRSA252)
    SA1029(ftsZ)cell division protein FtsZ  [1] (data from MRSA252)
    SA0727(gap)glyceraldehyde-3-phosphate dehydrogenase  [1] (data from MRSA252)
    SA1716(gatA)aspartyl/glutamyl-tRNA amidotransferase subunit A  [1] (data from MRSA252)
    SA1715(gatB)aspartyl/glutamyl-tRNA amidotransferase subunit B  [1] (data from MRSA252)
    SA1367(gcvT)glycine cleavage system aminomethyltransferase T  [1] (data from MRSA252)
    SA1959(glmS)glucosamine--fructose-6-phosphate aminotransferase  [1] (data from MRSA252)
    SA1837(groES)co-chaperonin GroES  [1] (data from MRSA252)
    SA1305(hu)DNA-binding protein II  [1] (data from MRSA252)
    SA1036(ileS)isoleucyl-tRNA synthetase  [1] (data from MRSA252)
    SA0512(ilvE)branched-chain amino acid aminotransferase  [1] (data from MRSA252)
    SA1112(infB)translation initiation factor IF-2  [1] (data from MRSA252)
    SA1504(infC)translation initiation factor IF-3  [1] (data from MRSA252)
    SA2356(isaA)hypothetical protein  [1] (data from MRSA252)
    SA0241(ispD)2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase  [1] (data from MRSA252)
    SA1170(katA)catalase  [1] (data from MRSA252)
    SA0232(lctE)L-lactate dehydrogenase  [1] (data from MRSA252)
    SA1579(leuS)leucyl-tRNA synthetase  [1] (data from MRSA252)
    SA0898(menB)naphthoate synthase  [1] (data from MRSA252)
    SA1963(mtlD)mannitol-1-phosphate 5-dehydrogenase  [1] (data from MRSA252)
    SA1926(murZ)UDP-N-acetylglucosamine 1-carboxyvinyltransferase  [1] (data from MRSA252)
    SA1301(ndk)nucleoside diphosphate kinase  [1] (data from MRSA252)
    SA1109(nusA)transcription elongation factor NusA  [1] (data from MRSA252)
    SA2392(panB)3-methyl-2-oxobutanoate hydroxymethyltransferase  [1] (data from MRSA252)
    SA1188(parE)DNA topoisomerase IV subunit B  [1] (data from MRSA252)
    SA1609(pckA)phosphoenolpyruvate carboxykinase  [1] (data from MRSA252)
    SA1938(pdp)pyrimidine-nucleoside phosphorylase  [1] (data from MRSA252)
    SA1521(pfkA)6-phosphofructokinase  [1] (data from MRSA252)
    SA0218(pflB)formate acetyltransferase  [1] (data from MRSA252)
    SA1117(pnpA)polynucleotide phosphorylase  [1] (data from MRSA252)
    SA1106(proS)prolyl-tRNA synthetase  [1] (data from MRSA252)
    SA0458(prs)ribose-phosphate pyrophosphokinase  [1] (data from MRSA252)
    SA0935(ptsI)phosphoenolpyruvate-protein phosphatase  [1] (data from MRSA252)
    SA0454(purR)pur operon repressor  [1] (data from MRSA252)
    SA1520(pykA)pyruvate kinase  [1] (data from MRSA252)
    SA1044(pyrC)dihydroorotase  [1] (data from MRSA252)
    SA2341(rocA)1-pyrroline-5-carboxylate dehydrogenase  [1] (data from MRSA252)
    SA0496(rplA)50S ribosomal protein L1  [1] (data from MRSA252)
    SA2044(rplB)50S ribosomal protein L2  [1] (data from MRSA252)
    SA2047(rplC)50S ribosomal protein L3  [1] (data from MRSA252)
    SA2046(rplD)50S ribosomal protein L4  [1] (data from MRSA252)
    SA2035(rplE)50S ribosomal protein L5  [1] (data from MRSA252)
    SA2033(rplF)50S ribosomal protein L6  [1] (data from MRSA252)
    SA0014(rplI)50S ribosomal protein L9  [1] (data from MRSA252)
    SA0497(rplJ)50S ribosomal protein L10  [1] (data from MRSA252)
    SA0498(rplL)50S ribosomal protein L7/L12  [1] (data from MRSA252)
    SA2017(rplM)50S ribosomal protein L13  [1] (data from MRSA252)
    SA2029(rplO)50S ribosomal protein L15  [1] (data from MRSA252)
    SA2032(rplR)50S ribosomal protein L18  [1] (data from MRSA252)
    SA1084(rplS)50S ribosomal protein L19  [1] (data from MRSA252)
    SA1502(rplT)50S ribosomal protein L20  [1] (data from MRSA252)
    SA1473(rplU)50S ribosomal protein L21  [1] (data from MRSA252)
    SA2042(rplV)50S ribosomal protein L22  [1] (data from MRSA252)
    SA2045(rplW)50S ribosomal protein L23  [1] (data from MRSA252)
    SA2036(rplX)50S ribosomal protein L24  [1] (data from MRSA252)
    SA1471(rpmA)50S ribosomal protein L27  [1] (data from MRSA252)
    SA1067(rpmB)50S ribosomal protein L28  [1] (data from MRSA252)
    SA2039(rpmC)50S ribosomal protein L29  [1] (data from MRSA252)
    SA1922(rpmE2)50S ribosomal protein L31  [1] (data from MRSA252)
    SA1503(rpmI)50S ribosomal protein L35  [1] (data from MRSA252)
    SA2023(rpoA)DNA-directed RNA polymerase subunit alpha  [1] (data from MRSA252)
    SA0501(rpoC)DNA-directed RNA polymerase subunit beta'  [1] (data from MRSA252)
    SA1099(rpsB)30S ribosomal protein S2  [1] (data from MRSA252)
    SA2041(rpsC)30S ribosomal protein S3  [1] (data from MRSA252)
    SAS052(rpsD)30S ribosomal protein S4  [1] (data from MRSA252)
    SA2031(rpsE)30S ribosomal protein S5  [1] (data from MRSA252)
    SA0352(rpsF)30S ribosomal protein S6  [1] (data from MRSA252)
    SA0504(rpsG)30S ribosomal protein S7  [1] (data from MRSA252)
    SA2016(rpsI)30S ribosomal protein S9  [1] (data from MRSA252)
    SA2024(rpsK)30S ribosomal protein S11  [1] (data from MRSA252)
    SA2025(rpsM)30S ribosomal protein S13  [1] (data from MRSA252)
    SA2038(rpsQ)30S ribosomal protein S17  [1] (data from MRSA252)
    SA0354(rpsR)30S ribosomal protein S18  [1] (data from MRSA252)
    SA2043(rpsS)30S ribosomal protein S19  [1] (data from MRSA252)
    SA1404(rpsU)30S ribosomal protein S21  [1] (data from MRSA252)
    SA1871(rsbV)anti-sigmaB factor antagonist  [1] (data from MRSA252)
    SA1382(sodA)superoxide dismutase SodA  [1] (data from MRSA252)
    SA0456(spoVG)regulatory protein SpoVG  [1] (data from MRSA252)
    SA1088(sucC)succinyl-CoA synthetase subunit beta  [1] (data from MRSA252)
    SA1506(thrS)threonyl-tRNA synthetase  [1] (data from MRSA252)
    SA1177(tkt)transketolase  [1] (data from MRSA252)
    SA1100(tsf)elongation factor Ts  [1] (data from MRSA252)
    SA0506(tuf)elongation factor Tu  [1] (data from MRSA252)
    SA1914(upp)uracil phosphoribosyltransferase  [1] (data from MRSA252)
    SA0231hypothetical protein  [1] (data from MRSA252)
    SA0295hypothetical protein  [1] (data from MRSA252)
    SA0342hypothetical protein  [1] (data from MRSA252)
    SA0437hypothetical protein  [1] (data from MRSA252)
    SA0466hypothetical protein  [1] (data from MRSA252)
    SA0468hypothetical protein  [1] (data from MRSA252)
    SA05082-amino-3-ketobutyrate CoA ligase  [1] (data from MRSA252)
    SA0511hypothetical protein  [1] (data from MRSA252)
    SA0587hypothetical protein  [1] (data from MRSA252)
    SA0605dihydroxyacetone kinase subunit DhaK  [1] (data from MRSA252)
    SA0627hypothetical protein  [1] (data from MRSA252)
    SA0637hypothetical protein  [1] (data from MRSA252)
    SA0790hypothetical protein  [1] (data from MRSA252)
    SA0859hypothetical protein  [1] (data from MRSA252)
    SA0873hypothetical protein  [1] (data from MRSA252)
    SA0940hypothetical protein  [1] (data from MRSA252)
    SA1032hypothetical protein  [1] (data from MRSA252)
    SA1069hypothetical protein  [1] (data from MRSA252)
    SA1256methionine sulfoxide reductase B  [1] (data from MRSA252)
    SA1360Xaa-Pro dipeptidase  [1] (data from MRSA252)
    SA1365glycine dehydrogenase subunit 2  [1] (data from MRSA252)
    SA1387hypothetical protein  [1] (data from MRSA252)
    SA1423hypothetical protein  [1] (data from MRSA252)
    SA1443hypothetical protein  [1] (data from MRSA252)
    SA1528hypothetical protein  [1] (data from MRSA252)
    SA1532hypothetical protein  [1] (data from MRSA252)
    SA1549hypothetical protein  [1] (data from MRSA252)
    SA1558bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase  [1] (data from MRSA252)
    SA1559hypothetical protein  [1] (data from MRSA252)
    SA1563hypothetical protein  [1] (data from MRSA252)
    SA1565hypothetical protein  [1] (data from MRSA252)
    SA1572dipeptidase PepV  [1] (data from MRSA252)
    SA1599translaldolase  [1] (data from MRSA252)
    SA1743hypothetical protein  [1] (data from MRSA252)
    SA2098glycerate dehydrogenase  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.142
    • Ymax_pos: 37
    • Cmax: 0.114
    • Cmax_pos: 25
    • Smax: 0.237
    • Smax_pos: 25
    • Smean: 0.133
    • D: 0.139
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MALDKDIVGSIEFLEVVGLQGSTYLLKGPNGENVKLNQSEMNDDDELEVGEEYSFFIYPNRSGELFATQNMPDITKDKYDFAKVLKTDRDGARIDVGLPREVLVPWEDLPKVKSLWPQPGDHLLVTLRIDRENHMYGRLASESVVENMFTPVHDDNLKNEVIEAKPYRVLRIGSFLLSESGYKIFVHESERKAEPRLGESVQVRIIGHNDKGELNGSFLPLAHERLDDDGQVIFDLLVEYDGELPFWDKSSPEAIKEVFNMSKGSFKRAIGHLYKQKIINIETGKITLTKKGWSRIDSKE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA1223 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.000 1.001 1.002 1.003 1.004 1.005 1.006 1.007 1.008 1.009 1.010 1.011 1.012 1.013 1.014 1.015 1.016 1.017 1.018 1.019 1.020 1.021 1.022 1.023 1.024 1.025 1.026 1.027 1.028 1.029 1.030 1.031 1.032 1.033 1.034 1.035 1.036 1.037 1.038 1.039 1.040 1.041 1.042 1.043 1.044 1.045 1.046 1.047 1.048 1.049 1.050 1.051 1.052 1.053 1.054 1.055 1.056 1.057 1.058 1.059 1.060 1.061 1.062 1.063 1.064 1.065 1.066 1.067 1.068 1.069 1.070 1.071 1.072 1.073 1.074 1.075 1.076 1.077 1.078 1.079 1.080 1.081 1.082 1.083 1.084 1.085 1.086 1.087 1.088 1.089 1.090 1.091 1.092 1.093 1.094 1.095 1.096 1.097 1.098 1.099 1.100 1.101 1.102 1.103 1.104 1.105 1.106 1.107 1.108 1.109 1.110 1.111 1.112 1.113 1.114 1.115 1.116 1.117 1.118 1.119 1.120 1.121 1.122 1.123 1.124 1.125 1.126 1.127 1.128 1.129 1.130 1.131 1.132 1.133 1.134 1.135 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]