From AureoWiki
Jump to: navigation, search

NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS06950 [old locus tag: SA1223 ]
  • pan locus tag?: SAUPAN003803000
  • symbol: SA_RS06950
  • pan gene symbol?: cvfB
  • synonym:
  • product: virulence factor B

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS06950 [old locus tag: SA1223 ]
  • symbol: SA_RS06950
  • product: virulence factor B
  • replicon: chromosome
  • strand: -
  • coordinates: 1396031..1396933
  • length: 903
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (1396031..1396933) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    ATGGCATTAGACAAAGATATAGTAGGTTCTATAGAATTCCTTGAAGTAGTAGGGTTACAA
    GGCTCAACTTACCTTTTAAAAGGACCAAACGGTGAAAACGTAAAGTTAAACCAATCAGAA
    ATGAACGATGATGATGAATTAGAAGTAGGTGAAGAATATAGTTTCTTCATTTATCCAAAC
    CGTTCAGGTGAATTATTTGCAACTCAAAATATGCCTGATATTACGAAAGATAAATATGAT
    TTTGCTAAAGTACTTAAAACGGATCGCGATGGGGCACGTATAGATGTTGGTTTACCCCGT
    GAAGTGTTAGTACCATGGGAAGATTTACCAAAAGTGAAATCACTATGGCCACAACCTGGT
    GATCATTTGCTAGTTACATTACGAATTGACCGTGAGAATCATATGTATGGACGTTTAGCG
    AGTGAATCTGTTGTAGAAAATATGTTTACACCTGTACACGATGATAATTTAAAAAACGAA
    GTCATTGAAGCCAAACCTTACCGCGTATTACGAATTGGTAGCTTCTTATTAAGCGAATCA
    GGTTACAAAATTTTCGTACATGAATCAGAACGTAAAGCTGAACCAAGATTAGGTGAATCT
    GTTCAAGTTAGAATTATCGGGCATAATGATAAAGGTGAGTTAAATGGTTCATTTTTACCA
    CTTGCACATGAACGTTTAGACGATGACGGCCAAGTCATCTTTGATTTACTAGTTGAATAT
    GATGGTGAATTACCATTCTGGGACAAATCAAGCCCTGAAGCGATTAAAGAAGTATTCAAT
    ATGAGTAAAGGTTCATTCAAACGTGCAATCGGTCACTTATATAAACAGAAGATTATTAAT
    ATAGAAACAGGTAAAATCACTTTAACTAAAAAAGGTTGGAGTCGAATTGACTCAAAAGAA
    TAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    903

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS06950 [old locus tag: SA1223 ]
  • symbol: SA_RS06950
  • description: virulence factor B
  • length: 300
  • theoretical pI: 4.82893
  • theoretical MW: 34184.5
  • GRAVY: -0.500667

Function[edit source | edit]

  • TIGRFAM:
  • TheSEED:
  • PFAM:
    OB (CL0021) S1_2; S1 domain (PF13509; HMM-score: 36.8)
    and 1 more
    S1; S1 RNA binding domain (PF00575; HMM-score: 19.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    SA_RS11130(deoA)pyrimidine-nucleoside phosphorylase  [1] (data from MRSA252)
    SA_RS09855(gatA)glutamyl-tRNA(Gln) amidotransferase subunit A  [1] (data from MRSA252)
    SA_RS06280(nusA)transcription termination/antitermination protein NusA  [1] (data from MRSA252)
    SA_RS0021550S ribosomal protein L9  [1] (data from MRSA252)
    SA_RS00310aminoglycoside O-nucleotidyltransferase ANT(4')-Ia  [1] (data from MRSA252)
    SA_RS01275formate acetyltransferase  [1] (data from MRSA252)
    SA_RS01355nitric oxide dioxygenase  [1] (data from MRSA252)
    SA_RS01365L-lactate dehydrogenase  [1] (data from MRSA252)
    SA_RS014252-C-methyl-D-erythritol 4-phosphate cytidylyltransferase  [1] (data from MRSA252)
    SA_RS017105'-nucleotidase, lipoprotein e(P4) family  [1] (data from MRSA252)
    SA_RS01960acetyl-CoA acyltransferase  [1] (data from MRSA252)
    SA_RS0201530S ribosomal protein S6  [1] (data from MRSA252)
    SA_RS0202530S ribosomal protein S18  [1] (data from MRSA252)
    SA_RS02490YbaB/EbfC family nucleoid-associated protein  [1] (data from MRSA252)
    SA_RS02615pur operon repressor  [1] (data from MRSA252)
    SA_RS02625stage V sporulation protein G  [1] (data from MRSA252)
    SA_RS02640ribose-phosphate pyrophosphokinase  [1] (data from MRSA252)
    SA_RS02685RNA-binding protein S1  [1] (data from MRSA252)
    SA_RS02695hypoxanthine-guanine phosphoribosyltransferase  [1] (data from MRSA252)
    SA_RS02710cysteine synthase  [1] (data from MRSA252)
    SA_RS0291050S ribosomal protein L1  [1] (data from MRSA252)
    SA_RS0291550S ribosomal protein L10  [1] (data from MRSA252)
    SA_RS0292050S ribosomal protein L7/L12  [1] (data from MRSA252)
    SA_RS02935DNA-directed RNA polymerase subunit beta'  [1] (data from MRSA252)
    SA_RS0295030S ribosomal protein S7  [1] (data from MRSA252)
    SA_RS02960elongation factor Tu  [1] (data from MRSA252)
    SA_RS029702-amino-3-ketobutyrate CoA ligase  [1] (data from MRSA252)
    SA_RS02985UDP-glucose 4-epimerase  [1] (data from MRSA252)
    SA_RS02990branched chain amino acid aminotransferase  [1] (data from MRSA252)
    SA_RS03265arginine--tRNA ligase  [1] (data from MRSA252)
    SA_RS03380metal ABC transporter substrate-binding protein  [1] (data from MRSA252)
    SA_RS03475dihydroxyacetone kinase subunit DhaK  [1] (data from MRSA252)
    SA_RS03645hypothetical protein  [1] (data from MRSA252)
    SA_RS04140aldehyde dehydrogenase  [1] (data from MRSA252)
    SA_RS04510TIGR01457 family HAD-type hydrolase  [1] (data from MRSA252)
    SA_RS047803-oxoacyl-ACP synthase III  [1] (data from MRSA252)
    SA_RS04865oligoendopeptidase F  [1] (data from MRSA252)
    SA_RS04915enoyl-ACP reductase  [1] (data from MRSA252)
    SA_RS04935hypothetical protein  [1] (data from MRSA252)
    SA_RS050951,4-dihydroxy-2-naphthoyl-CoA synthase  [1] (data from MRSA252)
    SA_RS05300phosphoenolpyruvate--protein phosphotransferase  [1] (data from MRSA252)
    SA_RS05325ribonuclease J 1  [1] (data from MRSA252)
    SA_RS05855cell division protein FtsA  [1] (data from MRSA252)
    SA_RS05860cell division protein FtsZ  [1] (data from MRSA252)
    SA_RS05875cell division protein SepF  [1] (data from MRSA252)
    SA_RS05895isoleucine--tRNA ligase  [1] (data from MRSA252)
    SA_RS05935dihydroorotase  [1] (data from MRSA252)
    SA_RS05945carbamoyl-phosphate synthase large chain  [1] (data from MRSA252)
    SA_RS0605050S ribosomal protein L28  [1] (data from MRSA252)
    SA_RS06060hypothetical protein  [1] (data from MRSA252)
    SA_RS06080malonyl CoA-ACP transacylase  [1] (data from MRSA252)
    SA_RS06095acyl carrier protein  [1] (data from MRSA252)
    SA_RS0614050S ribosomal protein L19  [1] (data from MRSA252)
    SA_RS06165succinyl-CoA ligase subunit beta  [1] (data from MRSA252)
    SA_RS0622530S ribosomal protein S2  [1] (data from MRSA252)
    SA_RS06235elongation factor Ts  [1] (data from MRSA252)
    SA_RS06245ribosome-recycling factor  [1] (data from MRSA252)
    SA_RS06265proline--tRNA ligase  [1] (data from MRSA252)
    SA_RS06295translation initiation factor IF-2  [1] (data from MRSA252)
    SA_RS06320polyribonucleotide nucleotidyltransferase  [1] (data from MRSA252)
    SA_RS06645catalase  [1] (data from MRSA252)
    SA_RS06690transketolase  [1] (data from MRSA252)
    SA_RS06750DNA topoisomerase IV subunit B  [1] (data from MRSA252)
    SA_RS07125peptide-methionine (R)-S-oxide reductase  [1] (data from MRSA252)
    SA_RS07360nucleoside-diphosphate kinase  [1] (data from MRSA252)
    SA_RS07385DNA-binding protein HU  [1] (data from MRSA252)
    SA_RS07420cytidylate kinase  [1] (data from MRSA252)
    SA_RS07700peptidase M24 family protein  [1] (data from MRSA252)
    SA_RS07725glycine dehydrogenase  [1] (data from MRSA252)
    SA_RS07735aminomethyltransferase  [1] (data from MRSA252)
    SA_RS07820superoxide dismutase  [1] (data from MRSA252)
    SA_RS07845DEAD/DEAH box family ATP-dependent RNA helicase  [1] (data from MRSA252)
    SA_RS0793030S ribosomal protein S21  [1] (data from MRSA252)
    SA_RS08030RNA-binding protein  [1] (data from MRSA252)
    SA_RS08135hypothetical protein  [1] (data from MRSA252)
    SA_RS0828550S ribosomal protein L27  [1] (data from MRSA252)
    SA_RS0829550S ribosomal protein L21  [1] (data from MRSA252)
    SA_RS0846050S ribosomal protein L20  [1] (data from MRSA252)
    SA_RS0846550S ribosomal protein L35  [1] (data from MRSA252)
    SA_RS08470translation initiation factor IF-3  [1] (data from MRSA252)
    SA_RS08480threonine--tRNA ligase  [1] (data from MRSA252)
    SA_RS08560pyruvate kinase  [1] (data from MRSA252)
    SA_RS08565ATP-dependent 6-phosphofructokinase  [1] (data from MRSA252)
    SA_RS08600universal stress protein  [1] (data from MRSA252)
    SA_RS08625universal stress protein UspA  [1] (data from MRSA252)
    SA_RS0867530S ribosomal protein S4  [1] (data from MRSA252)
    SA_RS08730serine protease  [1] (data from MRSA252)
    SA_RS08760formate--tetrahydrofolate ligase  [1] (data from MRSA252)
    SA_RS08780catabolite control protein A  [1] (data from MRSA252)
    SA_RS08790bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase  [1] (data from MRSA252)
    SA_RS08800hypothetical protein  [1] (data from MRSA252)
    SA_RS08820tRNA-binding protein  [1] (data from MRSA252)
    SA_RS08830thiol reductase thioredoxin  [1] (data from MRSA252)
    SA_RS08865dipeptidase PepV  [1] (data from MRSA252)
    SA_RS08900leucine--tRNA ligase  [1] (data from MRSA252)
    SA_RS09005transaldolase  [1] (data from MRSA252)
    SA_RS09060phosphoenolpyruvate carboxykinase (ATP)  [1] (data from MRSA252)
    SA_RS09850aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B  [1] (data from MRSA252)
    SA_RS10010thioredoxin family protein  [1] (data from MRSA252)
    SA_RS10540co-chaperone GroES  [1] (data from MRSA252)
    SA_RS10760anti-sigma B factor antagonist  [1] (data from MRSA252)
    SA_RS10855D-alanine--D-alanine ligase  [1] (data from MRSA252)
    SA_RS10940beta-hydroxyacyl-ACP dehydratase  [1] (data from MRSA252)
    SA_RS10965ATP synthase subunit beta  [1] (data from MRSA252)
    SA_RS11010uracil phosphoribosyltransferase  [1] (data from MRSA252)
    SA_RS1105050S ribosomal protein L31 type B  [1] (data from MRSA252)
    SA_RS11070UDP-N-acetylglucosamine 1-carboxyvinyltransferase  [1] (data from MRSA252)
    SA_RS11245glutamine--fructose-6-phosphate aminotransferase  [1] (data from MRSA252)
    SA_RS11265mannitol-1-phosphate 5-dehydrogenase  [1] (data from MRSA252)
    SA_RS1160030S ribosomal protein S9  [1] (data from MRSA252)
    SA_RS1160550S ribosomal protein L13  [1] (data from MRSA252)
    SA_RS11635DNA-directed RNA polymerase subunit alpha  [1] (data from MRSA252)
    SA_RS1164030S ribosomal protein S11  [1] (data from MRSA252)
    SA_RS1164530S ribosomal protein S13  [1] (data from MRSA252)
    SA_RS11660adenylate kinase  [1] (data from MRSA252)
    SA_RS1167050S ribosomal protein L15  [1] (data from MRSA252)
    SA_RS1168030S ribosomal protein S5  [1] (data from MRSA252)
    SA_RS1168550S ribosomal protein L18  [1] (data from MRSA252)
    SA_RS1169050S ribosomal protein L6  [1] (data from MRSA252)
    SA_RS1170550S ribosomal protein L5  [1] (data from MRSA252)
    SA_RS1171050S ribosomal protein L24  [1] (data from MRSA252)
    SA_RS1172030S ribosomal protein S17  [1] (data from MRSA252)
    SA_RS1172550S ribosomal protein L29  [1] (data from MRSA252)
    SA_RS1173530S ribosomal protein S3  [1] (data from MRSA252)
    SA_RS1174050S ribosomal protein L22  [1] (data from MRSA252)
    SA_RS1174530S ribosomal protein S19  [1] (data from MRSA252)
    SA_RS1175050S ribosomal protein L2  [1] (data from MRSA252)
    SA_RS1175550S ribosomal protein L23  [1] (data from MRSA252)
    SA_RS1176050S ribosomal protein L4  [1] (data from MRSA252)
    SA_RS1176550S ribosomal protein L3  [1] (data from MRSA252)
    SA_RS120602-hydroxyacid dehydrogenase  [1] (data from MRSA252)
    SA_RS13420L-glutamate gamma-semialdehyde dehydrogenase  [1] (data from MRSA252)
    SA_RS13495transglycosylase IsaA  [1] (data from MRSA252)
    SA_RS136903-methyl-2-oxobutanoate hydroxymethyltransferase  [1] (data from MRSA252)
    SA_RS13920arginine deiminase  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.142
    • Ymax_pos: 37
    • Cmax: 0.114
    • Cmax_pos: 25
    • Smax: 0.237
    • Smax_pos: 25
    • Smean: 0.133
    • D: 0.139
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 447085096 NCBI
  • RefSeq: WP_001162352 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MALDKDIVGSIEFLEVVGLQGSTYLLKGPNGENVKLNQSEMNDDDELEVGEEYSFFIYPNRSGELFATQNMPDITKDKYDFAKVLKTDRDGARIDVGLPREVLVPWEDLPKVKSLWPQPGDHLLVTLRIDRENHMYGRLASESVVENMFTPVHDDNLKNEVIEAKPYRVLRIGSFLLSESGYKIFVHESERKAEPRLGESVQVRIIGHNDKGELNGSFLPLAHERLDDDGQVIFDLLVEYDGELPFWDKSSPEAIKEVFNMSKGSFKRAIGHLYKQKIINIETGKITLTKKGWSRIDSKE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS06950 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.000 1.001 1.002 1.003 1.004 1.005 1.006 1.007 1.008 1.009 1.010 1.011 1.012 1.013 1.014 1.015 1.016 1.017 1.018 1.019 1.020 1.021 1.022 1.023 1.024 1.025 1.026 1.027 1.028 1.029 1.030 1.031 1.032 1.033 1.034 1.035 1.036 1.037 1.038 1.039 1.040 1.041 1.042 1.043 1.044 1.045 1.046 1.047 1.048 1.049 1.050 1.051 1.052 1.053 1.054 1.055 1.056 1.057 1.058 1.059 1.060 1.061 1.062 1.063 1.064 1.065 1.066 1.067 1.068 1.069 1.070 1.071 1.072 1.073 1.074 1.075 1.076 1.077 1.078 1.079 1.080 1.081 1.082 1.083 1.084 1.085 1.086 1.087 1.088 1.089 1.090 1.091 1.092 1.093 1.094 1.095 1.096 1.097 1.098 1.099 1.100 1.101 1.102 1.103 1.104 1.105 1.106 1.107 1.108 1.109 1.110 1.111 1.112 1.113 1.114 1.115 1.116 1.117 1.118 1.119 1.120 1.121 1.122 1.123 1.124 1.125 1.126 1.127 1.128 1.129 1.130 1.131 1.132 1.133 1.134 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]