From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS05470 [old locus tag: SACOL1072 ]
  • pan locus tag?: SAUPAN003276000
  • symbol: SACOL_RS05470
  • pan gene symbol?: folD
  • synonym:
  • product: bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS05470 [old locus tag: SACOL1072 ]
  • symbol: SACOL_RS05470
  • product: bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase
  • replicon: chromosome
  • strand: -
  • coordinates: 1081861..1082721
  • length: 861
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (1081861..1082721) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGGTTGCTAAAATTTTAGATGGTAAACAAATTGCCAAAGACTACAGACAGGGGTTACAA
    GATCAAGTTGAAGCGCTAAAAGAAAAGGGTTTTACACCTAAATTATCCGTTATATTAGTT
    GGTAATGATGGCGCTAGTCAAAGTTATGTTAGATCAAAAAAGAAAGCAGCTGAAAAAATT
    GGTATGATTTCAGAAATCGTACATTTGGAAGAAACAGCTACTGAAGAAGAAGTATTAAAC
    GAACTAAATAGACTAAATAATGATGATTCTGTAAGTGGTATTTTGGTACAAGTACCATTA
    CCAAAACAAGTTAGCGAACAGAAAATATTAGAAGCAATCAATCCTGAAAAAGATGTGGAC
    GGTTTTCATCCAATAAATATAGGGAAATTATATATCGATGAACAAACTTTTGTACCTTGC
    ACACCGCTCGGCATCATGGAAATATTAAAACATGCTGATATTGATTTAGAAGGTAAAAAT
    GCAGTTGTAATTGGACGAAGTCATATTGTCGGACAACCAGTTTCTAAGTTACTACTTCAA
    AAAAATGCATCAGTAACAATCTTACATTCTCGTTCAAAAGATATGGCATCATATTTAAAA
    GATGCTGATGTCATTGTCAGTGCAGTTGGTAAGCCTGGTTTAGTAACAAAAGATGTGGTC
    AAAGAAGGAGCAGTAATTATCGATGTTGGCAATACGCCAGATGAAAATGGCAAATTAAAA
    GGTGACGTTGATTATGATGCGGTTAAAGAAATTGCTGGAGCTATTACACCAGTTCCTGGT
    GGCGTTGGTCCATTAACAATTACTATGGTATTAAATAATACTTTGCTTGCAGAAAAAATG
    CGTCGAGGTATTGATTCGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    861

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS05470 [old locus tag: SACOL1072 ]
  • symbol: SACOL_RS05470
  • description: bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase
  • length: 286
  • theoretical pI: 5.24534
  • theoretical MW: 30843.3
  • GRAVY: -0.127972

Function[edit source | edit]

  • reaction:
    EC 3.5.4.9?  ExPASy
    Methenyltetrahydrofolate cyclohydrolase5,10-methenyltetrahydrofolate + H2O = 10-formyltetrahydrofolate
    EC 1.5.1.5?  ExPASy
    Methylenetetrahydrofolate dehydrogenase (NADP+)5,10-methylenetetrahydrofolate + NADP+ = 5,10-methenyltetrahydrofolate + NADPH
  • TIGRFAM:
    Unknown functionGeneralputative RNA-binding protein, YhbY family (TIGR00253; HMM-score: 11.1)
  • TheSEED:
  • PFAM:
    NADP_Rossmann (CL0063) THF_DHG_CYH_C; Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain (PF02882; HMM-score: 222.8)
    AA_dh_N (CL0603) THF_DHG_CYH; Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain (PF00763; HMM-score: 139.6)
    NADP_Rossmann (CL0063) AlaDh_PNT_C; Alanine dehydrogenase/PNT, C-terminal domain (PF01262; HMM-score: 17)
    Shikimate_DH; Shikimate / quinate 5-dehydrogenase (PF01488; HMM-score: 13.7)

Structure, modifications & interactions[edit source | edit]

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.156
    • Ymax_pos: 57
    • Cmax: 0.203
    • Cmax_pos: 57
    • Smax: 0.154
    • Smax_pos: 44
    • Smean: 0.088
    • D: 0.13
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446147982 NCBI
  • RefSeq: WP_000225837 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MVAKILDGKQIAKDYRQGLQDQVEALKEKGFTPKLSVILVGNDGASQSYVRSKKKAAEKIGMISEIVHLEETATEEEVLNELNRLNNDDSVSGILVQVPLPKQVSEQKILEAINPEKDVDGFHPINIGKLYIDEQTFVPCTPLGIMEILKHADIDLEGKNAVVIGRSHIVGQPVSKLLLQKNASVTILHSRSKDMASYLKDADVIVSAVGKPGLVTKDVVKEGAVIIDVGNTPDENGKLKGDVDYDAVKEIAGAITPVPGGVGPLTITMVLNNTLLAEKMRRGIDS

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS05470 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]