From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001861000
  • symbol?: lplA2
  • description?: lipoate-protein ligase

      descriptions from strain specific annotations:

    • lipoate-protein ligase
    • lipoyltransferase and lipoate-protein ligase
    • lipoate-protein ligase A family protein
    • Lipoate-protein ligase A
    • lipoyltransferase and lipoate-protein ligase family protein
    • lipoyltransferase and lipoate-ligase family protein
    • putative lipoate-protein ligase A
  • strand?: +
  • coordinates?: 2356799..2357836
  • synteny block?: BlockID0012350
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0326
    08BA02176:
    C248_0381
    11819-97:
    MS7_0317
    71193:
    ST398NM01_0408
    ECT-R 2:
    ECTR2_287
    ED133:
    SAOV_0353
    ED98:
    SAAV_0295
    HO 5096 0412:
    SAEMRSA15_02830
    JH1:
    SaurJH1_0386
    JH9:
    SaurJH9_0376
    JKD6008:
    SAA6008_00304 (lplA1)
    JKD6159:
    SAA6159_00303 (lplA1)
    LGA251:
    SARLGA251_02890
    M013:
    M013TW_0308
    MRSA252:
    SAR0324
    MSHR1132:
    SAMSHR1132_03010
    MSSA476:
    SAS0304
    Mu3:
    SAHV_0324
    Mu50:
    SAV0327
    MW2:
    MW0304
    RF122:
    SAB0277
    ST398:
    SAPIG0408
    T0131:
    SAT0131_00332
    TCH60:
    HMPREF0772_10168 (lplA)
    TW20:
    SATW20_03950
    USA300_TCH1516:
    USA300HOU_0348 (lplA1)
    VC40:
    SAVC_01385

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MYLIEPIRNGEYITDGAIALAMQVYVNQHIFLDEDILFPYYCDPKVEIGRFQNTAIEVNQ
    N315            MYLIEPIRNGEYITDGAIALAMQVYVNQHIFLDEDILFPYYCDPKVEIGRFQNTAIEVNQ
    NCTC8325        MYLIEPIRNGEYITDGAIALAMQVYVNQHIFLDEDILFPYYCDPKVEIGRFQNTAIEVNQ
    Newman          MYLIEPIRNGEYITDGAIALAMQVYVNQHIFLDEDILFPYYCDPKVEIGRFQNTAIEVNQ
    USA300_FPR3757  MYLIEPIRNGEYITDGAIALAMQVYVNQHIFLDEDILFPYYCDPKVEIGRFQNTAIEVNQ
                    ************************************************************

    COL             DYIDKHSIQVVRRDTGGGAVYVDKGAVNMCCILEQDTSIYGDFQRFYQPAIKALHTLGAT
    N315            DYIDKHSIQVVRRDTGGGAVYVDKGAVNMCCILEQDTSIYGDFQRFYQPAIKALHTLGAT
    NCTC8325        DYIDKHSIQVVRRDTGGGAVYVDKGAVNMCCILEQDTSIYGDFQRFYQPAIKALHTLGAT
    Newman          DYIDKHSIQVVRRDTGGGAVYVDKGAVNMCCILEQDTSIYGDFQRFYQPAIKALHTLGAT
    USA300_FPR3757  DYIDKHSIQVVRRDTGGGAVYVDKGAVNMCCILEQDTSIYGDFQRFYQPAIKALHTLGAT
                    ************************************************************

    COL             DVVQSGRNDLTLNGKKVSGAAMTLMNNRIYGGYSLLLDVNYEAMDKVLKPNRKKIASKGI
    N315            DVIQSGRNDLTLNGKKVSGAAMTLMNNRIYGGYSLLLDVNYEAMDKVLKPNRKKIASKGI
    NCTC8325        DVVQSGRNDLTLNGKKVSGAAMTLMNNRIYGGYSLLLDVNYEAMDKVLKPNRKKIASKGI
    Newman          DVVQSGRNDLTLNGKKVSGAAMTLMNNRIYGGYSLLLDVNYEAMDKVLKPNRKKIASKGI
    USA300_FPR3757  DVVQSGRNDLTLNGKKVSGAAMTLMNNRIYGGYSLLLDVNYEAMDKVLKPNRKKIASKGI
                    **:*********************************************************

    COL             KSVRARVGHLREALDEKYRDITIEEFKNLMVTQILGIDDIKEAKRYELTDADWEAIDELA
    N315            KSVRARVGHLREALDEKYRDITIEEFKNLMVTQILGIDDIKEAKRYELTDADWEAIDELA
    NCTC8325        KSVRARVGHLREALDEKYRDITIEEFKNLMVTQILGIDDIKEAKRYELTDADWEAIDELA
    Newman          KSVRARVGHLREALDEKYRDITIEEFKNLMVTQILGIDDIKEAKRYELTDADWEAIDELA
    USA300_FPR3757  KSVRARVGHLREALDEKYRDITIEEFKNLMVTQILGIDDIKEAKRYELTDADWEAIDELA
                    ************************************************************

    COL             DKKYKNWDWNYGKSPKYEYNRSERLSSGTVDITISVEQNRIADCRIYGDFFGQGDIKDVE
    N315            DKKYKNWDWNYGKSPKYEYNRSERLSSGTVDITISVEQNRIADCRIYGDFFGQGDIKDVE
    NCTC8325        DKKYKNWDWNYGKSPKYEYNRSERLSSGTVDITISVEQNRIADCRIYGDFFGQGDIKDVE
    Newman          DKKYKNWDWNYGKSPKYEYNRSERLSSGTVDITISVEQNRIADCRIYGDFFGQGDIKDVE
    USA300_FPR3757  DKKYKNWDWNYGKSPKYEYNRSERLSSGTVDITISVEQNRIADCRIYGDFFGQGDIKDVE
                    ************************************************************

    COL             EALQGTKMTREDLTHQLKQLDIVYYFGNVTVEALVDMILS
    N315            EALQGTKMTREDLMHQLKQLDIVYYFGNVTVESLVEMILS
    NCTC8325        EALQGTKMTREDLTHQLKQLDIVYYFGNVTVEALVDMILS
    Newman          EALQGTKMTREDLTHQLKQLDIVYYFGNVTVEALVDMILS
    USA300_FPR3757  EALQGTKMTREDLTHQLKQLDIVYYFSNVTVEALVDMILS
                    ************* ************.*****:**:****