From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS12655 [old locus tag: SACOL2412 ]
  • pan locus tag?: SAUPAN005948000
  • symbol: SACOL_RS12655
  • pan gene symbol?: tcyA
  • synonym:
  • product: amino acid ABC transporter substrate-binding protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS12655 [old locus tag: SACOL2412 ]
  • symbol: SACOL_RS12655
  • product: amino acid ABC transporter substrate-binding protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2471316..2472095
  • length: 780
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (2471316..2472095) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGAAAAGACTTTTATTTGTGATGATAGCTTTCGTTTTCATATTGGCTGCATGCGGAAAC
    AATTCGTCGAAAGACAAGGAAGCTAGTAAAGATAGCAAGACAATTAATGTTGGGACTGAG
    GGGACTTATGCACCATTTAGTTTCCACGATAAAGATGGTAAATTAACTGGTTACGATATT
    GATGTTATTAAAGCAGTGGCTAAAGAAGAAGGTTTAAAACTTAAATTTAATGAAACTTCT
    TGGGATTCTATGTTTGCAGGTTTAGACGCAGGGCGTTTTGATGTAATCGCGAACCAAGTA
    GGTATTAATCCTGATAGAGAAAAGAAATATAAATTTTCTAAGCCTTACACATTCTCAAGT
    GCTGTTTTAGTTATTCGTGAAAATGAAAAAGATATTAAAGATTTTGATGATGTTAAAGGT
    AAGAAGTTAGCACAAACATTCACATCTAATTATGGTAAATTAGCTAAGGATAAAGGTGCT
    GATATTACAAAAGTTGATGGCTTTAACCAATCAATGGATTTATTATTGTCTAAGCGTGTT
    GATGGTACATTTAATGATAGTCTGTCATACTTGGATTATAAAAAACAAAAACCTAATGCT
    AAGATCAAAGCAATCAAAGGTAATGCTGAACAAAGTAGATCTGCATTTGCATTTTCTAAA
    AAAGCAGATGATGAAACAGTTCAAAAATTCAATGATGGCTTGAAAAAAATCGAGGAAAAC
    GGTGAATTAGCTAAAATAGGTAAGAAATGGTTTGGTCAAGATGTTTCTAAATCTAAATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS12655 [old locus tag: SACOL2412 ]
  • symbol: SACOL_RS12655
  • description: amino acid ABC transporter substrate-binding protein
  • length: 259
  • theoretical pI: 9.8833
  • theoretical MW: 28903.7
  • GRAVY: -0.619691

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsAmino acids, peptides and amineslysine-arginine-ornithine-binding periplasmic protein (TIGR01096; HMM-score: 133.7)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesectoine/hydroxyectoine ABC transporter solute-binding protein EhuB (TIGR02995; HMM-score: 81.6)
    extracellular substrate-binding orphan protein, GRRM family (TIGR04262; HMM-score: 20)
    MetabolismEnergy metabolismOthermethanol oxidation system protein MoxJ (TIGR03870; HMM-score: 19.9)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsmethanol oxidation system protein MoxJ (TIGR03870; HMM-score: 19.9)
    MetabolismTransport and binding proteinsAmino acids, peptides and amineslipoprotein, PulS/OutS family (TIGR01004; HMM-score: 11.8)
  • TheSEED:
  • PFAM:
    PBP (CL0177) SBP_bac_3; Bacterial extracellular solute-binding proteins, family 3 (PF00497; HMM-score: 203.6)
    Lig_chan-Glu_bd; Ligated ion channel L-glutamate- and glycine-binding site (PF10613; HMM-score: 24.1)
    Phosphonate-bd; ABC transporter, phosphonate, periplasmic substrate-binding protein (PF12974; HMM-score: 21.5)
    no clan definedSspK; Small acid-soluble spore protein K family (PF08176; HMM-score: 13.8)
    PBP (CL0177) NMT1; NMT1/THI5 like (PF09084; HMM-score: 13.6)

Structure, modifications & interactions[edit source | edit]

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helix: 1
  • LocateP:
  • SignalP: Signal peptide length 25 aa
    • Ymax: 0.496
    • Ymax_pos: 25
    • Cmax: 0.305
    • Cmax_pos: 25
    • Smax: 0.913
    • Smax_pos: 15
    • Smean: 0.825
    • D: 0.625
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446748673 NCBI
  • RefSeq: WP_000825929 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKRLLFVMIAFVFILAACGNNSSKDKEASKDSKTINVGTEGTYAPFSFHDKDGKLTGYDIDVIKAVAKEEGLKLKFNETSWDSMFAGLDAGRFDVIANQVGINPDREKKYKFSKPYTFSSAVLVIRENEKDIKDFDDVKGKKLAQTFTSNYGKLAKDKGADITKVDGFNQSMDLLLSKRVDGTFNDSLSYLDYKKQKPNAKIKAIKGNAEQSRSAFAFSKKADDETVQKFNDGLKKIEENGELAKIGKKWFGQDVSKSK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS12655 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37

Relevant publications[edit source | edit]