From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_1448 [new locus tag: SAUSA300_RS07905 ]
  • pan locus tag?: SAUPAN004031000
  • symbol: SAUSA300_1448
  • pan gene symbol?: fur
  • synonym:
  • product: FUR family transcriptional regulator

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_1448 [new locus tag: SAUSA300_RS07905 ]
  • symbol: SAUSA300_1448
  • product: FUR family transcriptional regulator
  • replicon: chromosome
  • strand: -
  • coordinates: 1601372..1601821
  • length: 450
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    TTGGAAGAACGATTAAATCGCGTTAAGCAACAATTACAACAATCATCATATAAGCTAACG
    CCACAACGCGAAGCTACTGTTAGAGTTCTAATTGAAAATGAAAAAGATCATCTAAGTGCT
    GAAGACGTATATCTGAAAGTAAAAGATAAAGCGCCTGAAATTGGCTTGGCGACAGTATAC
    AGAACGTTAGAGTTGTTAGCTGAACTAAAAGTTGTCGACAAAATTAACTTTGGTGATGGC
    GTCGCTCGTTTTGATTTAAGAAAAGAAGGCGCAAAACATTTCCACCATCATTTAGTATGT
    ATGGAATGTGGTCGTGTAGATGAAATCGATGAAGATTTGTTACCAGAAGTTGAAAATCGA
    GTTGAAAATGAGTTCAATTTTAAAATTTTAGATCATCGTTTAACTTTCCATGGTGTGTGT
    GAAACGTGCCAAGCTAAAGGTAAAGGATAG
    60
    120
    180
    240
    300
    360
    420
    450

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_1448 [new locus tag: SAUSA300_RS07905 ]
  • symbol: SAUSA300_1448
  • description: FUR family transcriptional regulator
  • length: 149
  • theoretical pI: 6.15861
  • theoretical MW: 17243.6
  • GRAVY: -0.575168

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED:  
    Stress Response Oxidative stress Oxidative stress  Ferric uptake regulation protein FUR
    and 2 more
    Bacterial RNA-metabolizing Zn-dependent hydrolases  Ferric uptake regulation protein FUR
    RCJ pfr  Ferric uptake regulation protein FUR
  • PFAM:
    HTH (CL0123) FUR; Ferric uptake regulator family (PF01475; HMM-score: 131.8)

Structure, modifications & interactions[edit | edit source]

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.001453
    • TAT(Tat/SPI): 0.000154
    • LIPO(Sec/SPII): 0.000214
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MEERLNRVKQQLQQSSYKLTPQREATVRVLIENEKDHLSAEDVYLKVKDKAPEIGLATVYRTLELLAELKVVDKINFGDGVARFDLRKEGAKHFHHHLVCMECGRVDEIDEDLLPEVENRVENEFNFKILDHRLTFHGVCETCQAKGKG

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]