Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_2196 [new locus tag: SAUSA300_RS12110 ]
- pan locus tag?: SAUPAN005694000
- symbol: rpmC
- pan gene symbol?: rpmC
- synonym:
- product: 50S ribosomal protein L29
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_2196 [new locus tag: SAUSA300_RS12110 ]
- symbol: rpmC
- product: 50S ribosomal protein L29
- replicon: chromosome
- strand: -
- coordinates: 2366524..2366745
- length: 222
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3914223 NCBI
- RefSeq: YP_494831 NCBI
- BioCyc: GH3C-2183 BioCyc
- MicrobesOnline: 1293711 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181GTGGTGAAACAAATGAAAGCTAAGGAAATTAGAGACTTAACCACTTCAGAAATCGAAGAA
CAAATCAAATCTTCAAAAGAAGAGCTTTTTAACCTACGCTTTCAGTTAGCTACAGGTCAA
TTAGAAGAAACTGCACGTATTCGTACAGTAAGAAAAACGATTGCACGTCTAAAAACTGTT
GCTCGTGAAAGAGAAATTGAACAAAGTAAGGCTAATCAATAA60
120
180
222
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_2196 [new locus tag: SAUSA300_RS12110 ]
- symbol: RpmC
- description: 50S ribosomal protein L29
- length: 73
- theoretical pI: 10.5595
- theoretical MW: 8576.82
- GRAVY: -0.864384
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uL29 (TIGR00012; HMM-score: 76.7)
- TheSEED: and 1 more
- PFAM: Ribo_L29 (CL0346) Ribosomal_L29; Ribosomal L29 protein (PF00831; HMM-score: 84.8)and 2 moreno clan defined DnaG_DnaB_bind; DNA primase DnaG DnaB-binding (PF08278; HMM-score: 13.3)Ribo_L29 (CL0346) MRP-L47; Mitochondrial 39-S ribosomal protein L47 (MRP-L47) (PF06984; HMM-score: 12.4)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- protein partners:
SAUSA300_2039 (ddl) D-alanyl-alanine synthetase A [1] (data from MRSA252) SAUSA300_1080 (ftsZ) cell division protein FtsZ [1] (data from MRSA252) SAUSA300_1362 (hup) DNA-binding protein HU [1] (data from MRSA252) SAUSA300_1640 (icd) isocitrate dehydrogenase [1] (data from MRSA252) SAUSA300_1162 (infB) translation initiation factor IF-2 [1] (data from MRSA252) SAUSA300_1627 (infC) translation initiation factor IF-3 [1] (data from MRSA252) SAUSA300_0996 (lpdA) dihydrolipoamide dehydrogenase [1] (data from MRSA252) SAUSA300_0993 (pdhA) pyruvate dehydrogenase E1 component, alpha subunit [1] (data from MRSA252) SAUSA300_0994 (pdhB) pyruvate dehydrogenase E1 component, beta subunit [1] (data from MRSA252) SAUSA300_1790 (prsA) foldase protein PrsA [1] (data from MRSA252) SAUSA300_1644 (pyk) pyruvate kinase [1] (data from MRSA252) SAUSA300_1151 (pyrH) uridylate kinase [1] (data from MRSA252) SAUSA300_0523 (rplA) 50S ribosomal protein L1 [1] (data from MRSA252) SAUSA300_2201 (rplB) 50S ribosomal protein L2 [1] (data from MRSA252) SAUSA300_2203 (rplD) 50S ribosomal protein L4 [1] (data from MRSA252) SAUSA300_2192 (rplE) 50S ribosomal protein L5 [1] (data from MRSA252) SAUSA300_0524 (rplJ) 50S ribosomal protein L10 [1] (data from MRSA252) SAUSA300_2185 (rplO) 50S ribosomal protein L15 [1] (data from MRSA252) SAUSA300_2188 (rplR) 50S ribosomal protein L18 [1] (data from MRSA252) SAUSA300_1134 (rplS) 50S ribosomal protein L19 [1] (data from MRSA252) SAUSA300_1625 (rplT) 50S ribosomal protein L20 [1] (data from MRSA252) SAUSA300_1603 (rplU) 50S ribosomal protein L21 [1] (data from MRSA252) SAUSA300_2199 (rplV) 50S ribosomal protein L22 [1] (data from MRSA252) SAUSA300_2202 (rplW) 50S ribosomal protein L23 [1] (data from MRSA252) SAUSA300_2193 (rplX) 50S ribosomal protein L24 [1] (data from MRSA252) SAUSA300_1117 (rpmB) 50S ribosomal protein L28 [1] (data from MRSA252) SAUSA300_2074 (rpmE2) 50S ribosomal protein L31 type B [1] (data from MRSA252) SAUSA300_0527 (rpoB) DNA-directed RNA polymerase subunit beta [1] (data from MRSA252) SAUSA300_2198 (rpsC) 30S ribosomal protein S3 [1] (data from MRSA252) SAUSA300_1666 (rpsD) 30S ribosomal protein S4 [1] (data from MRSA252) SAUSA300_2187 (rpsE) 30S ribosomal protein S5 [1] (data from MRSA252) SAUSA300_0366 (rpsF) 30S ribosomal protein S6 [1] (data from MRSA252) SAUSA300_2171 (rpsI) 30S ribosomal protein S9 [1] (data from MRSA252) SAUSA300_2179 (rpsK) 30S ribosomal protein S11 [1] (data from MRSA252) SAUSA300_0530 (rpsL) 30S ribosomal protein S12 [1] (data from MRSA252) SAUSA300_2195 (rpsQ) 30S ribosomal protein S17 [1] (data from MRSA252) SAUSA300_0368 (rpsR) 30S ribosomal protein S18 [1] (data from MRSA252) SAUSA300_2200 (rpsS) 30S ribosomal protein S19 [1] (data from MRSA252) SAUSA300_1306 (sucA) 2-oxoglutarate dehydrogenase E1 component [1] (data from MRSA252) SAUSA300_1305 (sucB) dihydrolipoamide succinyltransferase [1] (data from MRSA252) SAUSA300_0307 5'-nucleotidase [1] (data from MRSA252) SAUSA300_0486 hypothetical protein [1] (data from MRSA252) SAUSA300_0618 ABC transporter substrate-binding protein [1] (data from MRSA252) SAUSA300_0658 LysR family transcriptional regulator [1] (data from MRSA252) SAUSA300_0668 hypothetical protein [1] (data from MRSA252) SAUSA300_0716 ribonucleotide-diphosphate reductase subunit alpha [1] (data from MRSA252) SAUSA300_0844 hypothetical protein [1] (data from MRSA252) SAUSA300_0989 hypothetical protein [1] (data from MRSA252) SAUSA300_0995 branched-chain alpha-keto acid dehydrogenase subunit E2 [1] (data from MRSA252) SAUSA300_1652 hypothetical protein [1] (data from MRSA252) SAUSA300_1674 putative serine protease HtrA [1] (data from MRSA252)
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00262
- TAT(Tat/SPI): 0.011844
- LIPO(Sec/SPII): 0.000459
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MVKQMKAKEIRDLTTSEIEEQIKSSKEELFNLRFQLATGQLEETARIRTVRKTIARLKTVAREREIEQSKANQ
⊟Experimental data[edit | edit source]
- experimentally validated: no data available
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: adk < secY < rplO < rpmD < rpsE < rplR < rplF < rpsH < rpsN < rplE < rplX < rplN < rpsQ < rpmC < rplP < rpsC < rplV < rpsS < rplB < rplW < rplD < rplC < rpsJ
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 1.45 1.46 1.47 1.48 1.49 1.50
Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]