From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0003 [new locus tag: NWMN_RS00020 ]
  • pan locus tag?: SAUPAN000010000
  • symbol: recF
  • pan gene symbol?: recF
  • synonym:
  • product: recombination protein F

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0003 [new locus tag: NWMN_RS00020 ]
  • symbol: recF
  • product: recombination protein F
  • replicon: chromosome
  • strand: +
  • coordinates: 3919..5031
  • length: 1113
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    ATGAAGTTAAATACACTCCAATTAGAAAATTATCGTAACTATGATGAGGTTACGTTGAAA
    TGTCATCCTGACGTGAATATCCTCATTGGAGAAAATGCACAAGGAAAGACAAATTTACTT
    GAATCAATTTATACCTTAGCTTTAGCAAAAAGTCATAGAACGAGTAATGATAAGGAACTC
    ATACGTTTTAATGCTGATTATGCTAAAATAGAAGGTGAGCTTAGTTATAGACACGGCACG
    ATGCCATTAACAATGTTTATAACTAAAAAAGGTAAACAAGTCAAAGTGAATCACTTAGAG
    CAAAGTCGTCTAACTCAATATATTGGACACCTCAATGTGGTTCTATTTGCGCCAGAAGAT
    TTGAATATTGTAAAAGGCTCTCCTCAAATAAGACGACGCTTTATAGATATGGAGTTGGGC
    CAAATTTCTGCTGTTTACTTAAATGATTTAGCTCAATACCAACGTATTTTAAAGCAAAAG
    AATAATTACTTAAAGCAGTTACAATTAGGCCAAAAAAAGGACTTAACAATGTTGGAAGTA
    TTAAATCAGCAGTTTGCTGAATATGCAATGAAAGTAACTGATAAACGTGCACATTTTATT
    CAAGAGCTAGAGTCGTTAGCTAAACCGATTCATGCTGGTATCACAAATGATAAAGAAGCG
    TTGTCGCTGAATTATTTACCTAGTCTTAAATTTGATTATGCTCAAAATGAAGCGGCACGA
    CTTGAAGAAATTATGTCTATTCTTAGCGATAATATGCAAAGAGAAAAAGAACGAGGCATT
    AGCTTATTCGGACCACATCGAGATGATATAAGTTTTGATGTGAATGGCATGGATGCTCAA
    ACATATGGTTCTCAAGGACAGCAACGTACAACGGCTTTGTCCATTAAATTAGCTGAAATT
    GAGTTAATGAATATCGAAGTTGGGGAATATCCCATCTTATTATTAGACGATGTACTCAGT
    GAATTAGATGATTCGCGTCAAACGCATTTATTAAGTACGATTCAGCATAAAGTACAAACA
    TTTGTCACTACGACATCTGTAGATGGTATTGATCATGAAATCATGAATAACGCTAAATTG
    TATCGTATTAATCAAGGTGAAATTATAAAGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1113

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0003 [new locus tag: NWMN_RS00020 ]
  • symbol: RecF
  • description: recombination protein F
  • length: 370
  • theoretical pI: 6.44688
  • theoretical MW: 42415.1
  • GRAVY: -0.444054

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA replication and repair protein RecF (TIGR00611; HMM-score: 474.6)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesurea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 13.2)
  • TheSEED:  
    DNA MetabolismDNA repairDNA repair, bacterial RecFOR pathway DNA recombination and repair protein RecF 
    Cell Division Subsystem including YidCD DNA recombination and repair protein RecF 
    Hypothetical Coupled to RecF DNA recombination and repair protein RecF 
  • PFAM:
    P-loop_NTPase (CL0023) SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 60.4)
    AAA_15; AAA ATPase domain (PF13175; HMM-score: 46)
    AAA_23; AAA domain (PF13476; HMM-score: 37.4)
    AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 28.3)
    AAA_27; AAA domain (PF13514; HMM-score: 21.9)
    AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 21.6)
    DUF2813; Protein of unknown function (DUF2813) (PF11398; HMM-score: 16.3)
    no clan definedERp29; Endoplasmic reticulum protein ERp29, C-terminal domain (PF07749; HMM-score: 11.4)
    P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 10.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    NWMN_1587(citC)isocitrate dehydrogenase  [1] (data from MRSA252)
    NWMN_0745(eno)phosphopyruvate hydratase  [1] (data from MRSA252)
    NWMN_1625(fhs)formate--tetrahydrofolate ligase  [1] (data from MRSA252)
    NWMN_1096(ftsZ)cell division protein FtsZ  [1] (data from MRSA252)
    NWMN_0509(fus)elongation factor G  [1] (data from MRSA252)
    NWMN_1580(gapB)glyceraldehyde 3-phosphate dehydrogenase 2  [1] (data from MRSA252)
    NWMN_1838(gatA)aspartyl/glutamyl-tRNA amidotransferase subunit A  [1] (data from MRSA252)
    NWMN_1348(ilvA)threonine dehydratase  [1] (data from MRSA252)
    NWMN_1178(infB)translation initiation factor IF-2  [1] (data from MRSA252)
    NWMN_1574(infC)translation initiation factor IF-3  [1] (data from MRSA252)
    NWMN_0176(ldh1)L-lactate dehydrogenase  [1] (data from MRSA252)
    NWMN_2446(mvaS)3-hydroxy-3-methylglutaryl coenzyme A synthase  [1] (data from MRSA252)
    NWMN_0962(pdhD)dihydrolipoamide dehydrogenase  [1] (data from MRSA252)
    NWMN_0162(pflB)formate acetyltransferase  [1] (data from MRSA252)
    NWMN_0959(phdA)pyruvate dehydrogenase E1 component, alpha subunit  [1] (data from MRSA252)
    NWMN_0960(phdB)pyruvate dehydrogenase E1 component, beta subunit  [1] (data from MRSA252)
    NWMN_1592(pykA)pyruvate kinase  [1] (data from MRSA252)
    NWMN_0500(rplA)50S ribosomal protein L1  [1] (data from MRSA252)
    NWMN_2149(rplB)50S ribosomal protein L2  [1] (data from MRSA252)
    NWMN_2152(rplC)50S ribosomal protein L3  [1] (data from MRSA252)
    NWMN_2151(rplD)50S ribosomal protein L4  [1] (data from MRSA252)
    NWMN_2140(rplE)50S ribosomal protein L5  [1] (data from MRSA252)
    NWMN_2137(rplF)50S ribosomal protein L6  [1] (data from MRSA252)
    NWMN_0501(rplJ)50S ribosomal protein L10  [1] (data from MRSA252)
    NWMN_0499(rplK)50S ribosomal protein L11  [1] (data from MRSA252)
    NWMN_0502(rplL)50S ribosomal protein L7/L12  [1] (data from MRSA252)
    NWMN_2133(rplO)50S ribosomal protein L15  [1] (data from MRSA252)
    NWMN_2125(rplQ)50S ribosomal protein L17  [1] (data from MRSA252)
    NWMN_1151(rplS)50S ribosomal protein L19  [1] (data from MRSA252)
    NWMN_1549(rplU)50S ribosomal protein L21  [1] (data from MRSA252)
    NWMN_2147(rplV)50S ribosomal protein L22  [1] (data from MRSA252)
    NWMN_2150(rplW)50S ribosomal protein L23  [1] (data from MRSA252)
    NWMN_1166(rpsB)30S ribosomal protein S2  [1] (data from MRSA252)
    NWMN_2146(rpsC)30S ribosomal protein S3  [1] (data from MRSA252)
    NWMN_1613(rpsD)30S ribosomal protein S4  [1] (data from MRSA252)
    NWMN_2135(rpsE)30S ribosomal protein S5  [1] (data from MRSA252)
    NWMN_2138(rpsH)30S ribosomal protein S8  [1] (data from MRSA252)
    NWMN_2127(rpsK)30S ribosomal protein S11  [1] (data from MRSA252)
    NWMN_2143(rpsQ)30S ribosomal protein S17  [1] (data from MRSA252)
    NWMN_1326(sucA)2-oxoglutarate dehydrogenase E1 component  [1] (data from MRSA252)
    NWMN_1325(sucB)dihydrolipoamide succinyltransferase  [1] (data from MRSA252)
    NWMN_0510(tufA)elongation factor Tu  [1] (data from MRSA252)
    NWMN_0811hypothetical protein  [1] (data from MRSA252)
    NWMN_0956hypothetical protein  [1] (data from MRSA252)
    NWMN_1604universal stress protein family protein  [1] (data from MRSA252)
    NWMN_1985ATP-dependent RNA helicase DEAD box family protein  [1] (data from MRSA252)
    NWMN_2086alkaline shock protein 23  [1] (data from MRSA252)
    NWMN_2504malate:quinone oxidoreductase  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.133
    • Ymax_pos: 15
    • Cmax: 0.131
    • Cmax_pos: 36
    • Smax: 0.226
    • Smax_pos: 7
    • Smean: 0.167
    • D: 0.147
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKLNTLQLENYRNYDEVTLKCHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKELIRFNADYAKIEGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRLTQYIGHLNVVLFAPEDLNIVKGSPQIRRRFIDMELGQISAVYLNDLAQYQRILKQKNNYLKQLQLGQKKDLTMLEVLNQQFAEYAMKVTDKRAHFIQELESLAKPIHAGITNDKEALSLNYLPSLKFDYAQNEAARLEEIMSILSDNMQREKERGISLFGPHRDDISFDVNGMDAQTYGSQGQQRTTALSIKLAEIELMNIEVGEYPILLLDDVLSELDDSRQTHLLSTIQHKVQTFVTTTSVDGIDHEIMNNAKLYRINQGEIIK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 1.45 1.46 1.47 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]