From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01487
  • pan locus tag?: SAUPAN003931000
  • symbol: ubiE
  • pan gene symbol?: ubiE
  • synonym:
  • product: ubiquinone/menaquinone biosynthesis methyltransferase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_01487
  • symbol: ubiE
  • product: ubiquinone/menaquinone biosynthesis methyltransferase
  • replicon: chromosome
  • strand: -
  • coordinates: 1443873..1444475
  • length: 603
  • essential: no [1] DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGAAAGACATGGGTGTTAGAAAAGGGACGAAAGCATTAGATGTTTGTTGTGGTACTGGT
    GATTGGACAATCGCATTAAGCAAAGCTGTAGGACCAACAGGTGAAGTTACTGGTATTGAC
    TTTAGTGAGAATATGTTAGAAGTAGGAAAAGAAAAAACTGCTTCAATGGAAAATGTTAAA
    CTTGTTCATGGTGATGCAATGGAATTGCCGTTTGAAGACAATTCTTTTGATTATGTAACA
    ATTGGGTTTGGATTAAGAAATGTGCCAGACTATTTAGTCGCGTTAAAAGAAATGAATAGA
    GTACTTAAACCAGGTGGTATGGTGGTATGTCTTGAAACGAGCCAACCAACTTTGCCAGTC
    TTTAAACAAATGTATGCACTATACTTTAAATTTGTTATGCCTATTTTTGGAAAATTATTT
    GCAAAATCAAAAGAAGAATATGAATGGTTACAGCAATCTACGTTTAATTTTCCTGGAAAA
    GAAGAGTTGAAGCGCATGTTTGAAGAAGCAGGTTTCATAAATGTAAGAGTACGTAGTTTT
    ACAGGGGGCGTTGCTGCAATGCACCTTGGCTATAAAGAAAAAGATAATACCAAAGGTGAT
    TAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    603

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_01487
  • symbol: UbiE
  • description: ubiquinone/menaquinone biosynthesis methyltransferase
  • length: 200
  • theoretical pI: 5.87366
  • theoretical MW: 22370.8
  • GRAVY: -0.2145

Function[edit source | edit]

  • reaction:
    EC 2.1.1.-?  ExPASy
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMenaquinone and ubiquinonedemethylmenaquinone methyltransferase (TIGR02752; EC 2.1.1.163; HMM-score: 342.7)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMenaquinone and ubiquinoneubiquinone/menaquinone biosynthesis methyltransferase (TIGR01934; EC 2.1.1.-; HMM-score: 246.1)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersBiotinmalonyl-acyl carrier protein O-methyltransferase BioC (TIGR02072; EC 2.1.1.-; HMM-score: 62.1)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalaminprecorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit (TIGR02469; EC 2.1.1.132; HMM-score: 39.4)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersGlutathione and analogsputative 4-mercaptohistidine N1-methyltranferase (TIGR04345; HMM-score: 34.1)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMenaquinone and ubiquinone3-demethylubiquinone-9 3-O-methyltransferase (TIGR01983; EC 2.1.1.64; HMM-score: 33.9)
    Genetic information processingProtein fateProtein modification and repairprotein-(glutamine-N5) methyltransferase, release factor-specific (TIGR03534; EC 2.1.1.-; HMM-score: 31.3)
    Unknown functionEnzymes of unknown specificitytRNA (cmo5U34)-methyltransferase (TIGR00740; EC 2.1.1.-; HMM-score: 28.7)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersChlorophyll and bacteriochlorphyllmagnesium protoporphyrin O-methyltransferase (TIGR02021; EC 2.1.1.11; HMM-score: 27.3)
    methyltransferase, FxLD system (TIGR04364; HMM-score: 27.2)
    Genetic information processingProtein fateProtein modification and repairprotein-L-isoaspartate O-methyltransferase (TIGR00080; EC 2.1.1.77; HMM-score: 26.6)
    MetabolismAmino acid biosynthesisAspartate familymethionine biosynthesis protein MetW (TIGR02081; HMM-score: 23.8)
    Genetic information processingProtein fateProtein modification and repairmethyltransferase, HemK family (TIGR00536; HMM-score: 21.4)
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationprotein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific (TIGR03533; EC 2.1.1.-; HMM-score: 20.4)
    Genetic information processingProtein synthesistRNA and rRNA base modificationribosomal RNA small subunit methyltransferase A (TIGR00755; EC 2.1.1.182; HMM-score: 19.2)
    Genetic information processingProtein synthesistRNA and rRNA base modificationribosomal RNA large subunit methyltransferase J (TIGR00438; EC 2.1.1.166; HMM-score: 16.6)
    Genetic information processingProtein synthesistRNA and rRNA base modificationtRNA (guanine-N(7)-)-methyltransferase (TIGR00091; EC 2.1.1.33; HMM-score: 15.6)
    Genetic information processingProtein synthesistRNA and rRNA base modification23S rRNA (uracil-5-)-methyltransferase RumA (TIGR00479; EC 2.1.1.-; HMM-score: 12.7)
    Hypothetical proteinsConservedputative methyltransferase, TIGR01177 family (TIGR01177; HMM-score: 12.7)
    methyltransferase, ATP-grasp peptide maturase system (TIGR04188; HMM-score: 12.4)
    methyltransferase, Rta_06860 family (TIGR04290; EC 2.1.1.-; HMM-score: 12.1)
    2-ketoarginine methyltransferase (TIGR04543; EC 2.1.1.243; HMM-score: 11.9)
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationputative protein-(glutamine-N5) methyltransferase, unknown substrate-specific (TIGR03704; EC 2.1.1.-; HMM-score: 11.5)
  • TheSEED:  
    Menaquinone and Phylloquinone Biosynthesis 2-heptaprenyl-1,4-naphthoquinone methyltransferase (EC 2.1.1.163) 
    Menaquinone and Phylloquinone Biosynthesis 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase (EC 2.1.1.201) 
    Menaquinone biosynthesis from chorismate via 1,4-dihydroxy-2-naphthoate 2-heptaprenyl-1,4-naphthoquinone methyltransferase (EC 2.1.1.163) 
  • PFAM:
    NADP_Rossmann (CL0063) Ubie_methyltran; ubiE/COQ5 methyltransferase family (PF01209; HMM-score: 266.4)
    Methyltransf_25; Methyltransferase domain (PF13649; HMM-score: 93.8)
    Methyltransf_11; Methyltransferase domain (PF08241; HMM-score: 86.1)
    Methyltransf_31; Methyltransferase domain (PF13847; HMM-score: 81.1)
    Methyltransf_23; Methyltransferase domain (PF13489; HMM-score: 64)
    Methyltransf_12; Methyltransferase domain (PF08242; HMM-score: 56.9)
    PCMT; Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) (PF01135; HMM-score: 39.2)
    FtsJ; FtsJ-like methyltransferase (PF01728; HMM-score: 30.7)
    Methyltransf_4; Putative methyltransferase (PF02390; HMM-score: 29.2)
    MTS; Methyltransferase small domain (PF05175; HMM-score: 21.6)
    MetW; Methionine biosynthesis protein MetW (PF07021; HMM-score: 20.7)
    Methyltransf_8; Hypothetical methyltransferase (PF05148; HMM-score: 20.7)
    GCD14; tRNA methyltransferase complex GCD14 subunit (PF08704; HMM-score: 19.7)
    Methyltransf_24; Methyltransferase domain (PF13578; HMM-score: 19.6)
    CMAS; Mycolic acid cyclopropane synthetase (PF02353; HMM-score: 18.7)
    Rsm22; Mitochondrial small ribosomal subunit Rsm22 (PF09243; HMM-score: 17.7)
    Methyltransf_15; RNA cap guanine-N2 methyltransferase (PF09445; HMM-score: 14.9)
    Methyltr_RsmB-F; 16S rRNA methyltransferase RsmB/F (PF01189; HMM-score: 14.8)
    RrnaAD; Ribosomal RNA adenine dimethylase (PF00398; HMM-score: 14.3)
    Methyltransf_18; Methyltransferase domain (PF12847; HMM-score: 14)
    ADH_zinc_N; Zinc-binding dehydrogenase (PF00107; HMM-score: 13.4)
    NodS; Nodulation protein S (NodS) (PF05401; HMM-score: 13.1)
    Methyltransf_3; O-methyltransferase (PF01596; HMM-score: 12.3)
    Methyltransf_29; Putative S-adenosyl-L-methionine-dependent methyltransferase (PF03141; HMM-score: 11.7)
    PrmA; Ribosomal protein L11 methyltransferase (PrmA) (PF06325; HMM-score: 11.2)

Structure, modifications & interactions[edit source | edit]

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.174
    • Ymax_pos: 32
    • Cmax: 0.121
    • Cmax_pos: 32
    • Smax: 0.374
    • Smax_pos: 1
    • Smean: 0.216
    • D: 0.19
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKDMGVRKGTKALDVCCGTGDWTIALSKAVGPTGEVTGIDFSENMLEVGKEKTASMENVKLVHGDAMELPFEDNSFDYVTIGFGLRNVPDYLVALKEMNRVLKPGGMVVCLETSQPTLPVFKQMYALYFKFVMPIFGKLFAKSKEEYEWLQQSTFNFPGKEELKRMFEEAGFINVRVRSFTGGVAAMHLGYKEKDNTKGD

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Roy R Chaudhuri, Andrew G Allen, Paul J Owen, Gil Shalom, Karl Stone, Marcus Harrison, Timothy A Burgis, Michael Lockyer, Jorge Garcia-Lara, Simon J Foster, Stephen J Pleasance, Sarah E Peters, Duncan J Maskell, Ian G Charles
    Comprehensive identification of essential Staphylococcus aureus genes using Transposon-Mediated Differential Hybridisation (TMDH).
    BMC Genomics: 2009, 10;291
    [PubMed:19570206] [WorldCat.org] [DOI] (I e)
  2. 2.00 2.01 2.02 2.03 2.04 2.05 2.06 2.07 2.08 2.09 2.10 2.11 2.12 2.13 2.14 2.15 2.16 2.17 2.18 2.19 2.20 2.21 2.22 2.23 2.24 2.25 2.26 2.27 2.28 2.29 2.30 2.31 2.32 2.33 2.34 2.35 2.36 2.37 2.38 2.39 2.40 2.41 2.42 2.43 2.44 2.45 2.46 2.47 2.48 2.49 2.50 2.51 2.52 2.53 2.54 2.55 2.56 2.57 2.58 2.59 2.60 2.61 2.62 2.63 2.64 2.65 2.66 2.67 2.68 2.69 2.70 2.71 2.72 2.73 2.74 2.75 2.76 2.77 2.78 2.79 2.80 2.81 2.82 2.83 2.84 2.85 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)
  3. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-3661
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  4. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]