Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA0826 [new locus tag: SA_RS04695 ]
- pan locus tag?: SAUPAN003074000
- symbol: spsB
- pan gene symbol?: spsB
- synonym:
- product: type-1 signal peptidase 1B
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA0826 [new locus tag: SA_RS04695 ]
- symbol: spsB
- product: type-1 signal peptidase 1B
- replicon: chromosome
- strand: +
- coordinates: 931642..932217
- length: 576
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1123641 NCBI
- RefSeq: NP_374087 NCBI
- BioCyc:
- MicrobesOnline: 103113 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541TTGAAAAAAGAATTATTGGAATGGATTATTTCAATTGCAGTCGCTTTTGTCATTTTATTT
ATAGTAGGTAAATTTATTGTTACACCATATACAATTAAAGGTGAATCAATGGATCCAACT
TTGAAAGATGGCGAGCGAGTAGCTGTAAACATTATTGGATATAAAACAGGTGGTTTGGAA
AAAGGTAATGTAGTTGTCTTCCATGCAAACAAAAATGATGACTATGTTAAACGTGTCATC
GGTGTTCCTGGTGATAAAGTAGAATATAAAAATGATACATTATATGTCAATGGTAAAAAA
CAAGATGAACCATATTTAAACTATAATTTAAAACATAAACAAGGTGATTACATTACTGGG
ACTTTCCAAGTTAAAGATTTACCGAATGCGAATCCTAAATCAAATGTCATTCCAAAAGGT
AAATATTTAGTTCTTGGAGATAATCGTGAAGTAAGTAAAGATAGCCGTGCGTTTGGCCTC
ATTGATGAAGACCAAATTGTTGGTAAAGTTTCATTTAGATTCTGGCCATTTAGTGAATTT
AAACATAATTTCAATCCTGAAAATACTAAAAATTAA60
120
180
240
300
360
420
480
540
576
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA0826 [new locus tag: SA_RS04695 ]
- symbol: SpsB
- description: type-1 signal peptidase 1B
- length: 191
- theoretical pI: 9.53343
- theoretical MW: 21691.7
- GRAVY: -0.436126
⊟Function[edit | edit source]
- reaction: EC 3.4.21.89? ExPASySignal peptidase I Cleavage of hydrophobic, N-terminal signal or leader sequences from secreted and periplasmic proteins
- TIGRFAM: Protein fate Protein and peptide secretion and trafficking signal peptidase I (TIGR02227; EC 3.4.21.89; HMM-score: 178)and 4 moreCellular processes Detoxification nickel-type superoxide dismutase maturation protease (TIGR02754; EC 3.4.21.-; HMM-score: 49.8)Protein fate Protein modification and repair nickel-type superoxide dismutase maturation protease (TIGR02754; EC 3.4.21.-; HMM-score: 49.8)conjugative transfer signal peptidase TraF (TIGR02771; HMM-score: 36.4)signal peptidase I (TIGR02228; EC 3.4.21.89; HMM-score: 29.1)
- TheSEED: Clustering-based subsystems Probably GTP or GMP signaling related CBSS-176299.4.peg.1292 Signal peptidase I (EC 3.4.21.89)and 1 more
- PFAM: Peptidase_SF (CL0299) Peptidase_S24; Peptidase S24-like (PF00717; HMM-score: 72.8)and 1 morePeptidase_S26; Signal peptidase, peptidase S26 (PF10502; HMM-score: 36.1)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- protein partners:
SA0033 (aadD) kanamycin nucleotidyltransferase [1] (data from MRSA252) SA1533 (ackA) acetate kinase [1] (data from MRSA252) SA0366 (ahpC) alkyl hydroperoxide reductase [1] (data from MRSA252) SA2428 (arcA) arginine deiminase [1] (data from MRSA252) SA2427 (arcB) ornithine carbamoyltransferase [1] (data from MRSA252) SA1984 (asp23) alkaline shock protein 23 [1] (data from MRSA252) SA1517 (citC) isocitrate dehydrogenase [1] (data from MRSA252) SA0483 (clpC) endopeptidase [1] (data from MRSA252) SA1234 (cspA) cold-shock protein CspA [1] (data from MRSA252) SA0471 (cysK) hypothetical protein [1] (data from MRSA252) SA1940 (deoD) purine nucleoside phosphorylase [1] (data from MRSA252) SA1409 (dnaK) molecular chaperone DnaK [1] (data from MRSA252) SA0002 (dnaN) DNA polymerase III subunit beta [1] (data from MRSA252) SA0133 (dra) deoxyribose-phosphate aldolase [1] (data from MRSA252) SA0731 (eno) phosphopyruvate hydratase [1] (data from MRSA252) SA0843 (fab) 3-oxoacyl-ACP synthase [1] (data from MRSA252) SA1074 (fabG) 3-oxoacyl-ACP reductase [1] (data from MRSA252) SA1927 (fbaA) fructose-bisphosphate aldolase [1] (data from MRSA252) SA1553 (fhs) formate--tetrahydrofolate ligase [1] (data from MRSA252) SA1029 (ftsZ) cell division protein FtsZ [1] (data from MRSA252) SA0505 (fus) elongation factor G [1] (data from MRSA252) SA0727 (gap) glyceraldehyde-3-phosphate dehydrogenase [1] (data from MRSA252) SA1510 (gapB) glyceraldehyde 3-phosphate dehydrogenase 2 [1] (data from MRSA252) SA1716 (gatA) aspartyl/glutamyl-tRNA amidotransferase subunit A [1] (data from MRSA252) SA1959 (glmS) glucosamine--fructose-6-phosphate aminotransferase [1] (data from MRSA252) SA1394 (glyS) glycyl-tRNA synthetase [1] (data from MRSA252) SA1342 (gnd) 6-phosphogluconate dehydrogenase [1] (data from MRSA252) SA0376 (guaA) GMP synthase [1] (data from MRSA252) SA0375 (guaB) inositol-monophosphate dehydrogenase [1] (data from MRSA252) SA0006 (gyrA) DNA gyrase subunit A [1] (data from MRSA252) SA1112 (infB) translation initiation factor IF-2 [1] (data from MRSA252) SA1504 (infC) translation initiation factor IF-3 [1] (data from MRSA252) SA0232 (lctE) L-lactate dehydrogenase [1] (data from MRSA252) SA2400 (mqo2) malate:quinone oxidoreductase [1] (data from MRSA252) SA1926 (murZ) UDP-N-acetylglucosamine 1-carboxyvinyltransferase [1] (data from MRSA252) SA0686 (nrdE) ribonucleotide-diphosphate reductase subunit alpha [1] (data from MRSA252) SA1244 (odhB) dihydrolipoamide succinyltransferase [1] (data from MRSA252) SA0943-1 (pdhA) pyruvate dehydrogenase E1 component subunit alpha [1] (data from MRSA252) SA0944 (pdhB) pyruvate dehydrogenase E1 component subunit beta [1] (data from MRSA252) SA0946 (pdhD) dihydrolipoamide dehydrogenase [1] (data from MRSA252) SA1938 (pdp) pyrimidine-nucleoside phosphorylase [1] (data from MRSA252) SA0218 (pflB) formate acetyltransferase [1] (data from MRSA252) SA0823 (pgi) glucose-6-phosphate isomerase [1] (data from MRSA252) SA0728 (pgk) phosphoglycerate kinase [1] (data from MRSA252) SA0730 (pgm) phosphoglyceromutase [1] (data from MRSA252) SA1117 (pnpA) polynucleotide phosphorylase [1] (data from MRSA252) SA0934 (ptsH) phosphocarrier protein HPr [1] (data from MRSA252) SA0935 (ptsI) phosphoenolpyruvate-protein phosphatase [1] (data from MRSA252) SA1520 (pykA) pyruvate kinase [1] (data from MRSA252) SA0496 (rplA) 50S ribosomal protein L1 [1] (data from MRSA252) SA2044 (rplB) 50S ribosomal protein L2 [1] (data from MRSA252) SA2046 (rplD) 50S ribosomal protein L4 [1] (data from MRSA252) SA2035 (rplE) 50S ribosomal protein L5 [1] (data from MRSA252) SA2033 (rplF) 50S ribosomal protein L6 [1] (data from MRSA252) SA0497 (rplJ) 50S ribosomal protein L10 [1] (data from MRSA252) SA0495 (rplK) 50S ribosomal protein L11 [1] (data from MRSA252) SA0498 (rplL) 50S ribosomal protein L7/L12 [1] (data from MRSA252) SA2017 (rplM) 50S ribosomal protein L13 [1] (data from MRSA252) SA2029 (rplO) 50S ribosomal protein L15 [1] (data from MRSA252) SA2040 (rplP) 50S ribosomal protein L16 [1] (data from MRSA252) SA2022 (rplQ) 50S ribosomal protein L17 [1] (data from MRSA252) SA2032 (rplR) 50S ribosomal protein L18 [1] (data from MRSA252) SA1084 (rplS) 50S ribosomal protein L19 [1] (data from MRSA252) SA1502 (rplT) 50S ribosomal protein L20 [1] (data from MRSA252) SA1473 (rplU) 50S ribosomal protein L21 [1] (data from MRSA252) SA2042 (rplV) 50S ribosomal protein L22 [1] (data from MRSA252) SA2045 (rplW) 50S ribosomal protein L23 [1] (data from MRSA252) SA0459 (rplY) 50S ribosomal protein L25 [1] (data from MRSA252) SA2039 (rpmC) 50S ribosomal protein L29 [1] (data from MRSA252) SA2030 (rpmD) 50S ribosomal protein L30 [1] (data from MRSA252) SA1922 (rpmE2) 50S ribosomal protein L31 [1] (data from MRSA252) SA2023 (rpoA) DNA-directed RNA polymerase subunit alpha [1] (data from MRSA252) SA0500 (rpoB) DNA-directed RNA polymerase subunit beta [1] (data from MRSA252) SA0501 (rpoC) DNA-directed RNA polymerase subunit beta' [1] (data from MRSA252) SA1308 (rpsA) 30S ribosomal protein S1 [1] (data from MRSA252) SA1099 (rpsB) 30S ribosomal protein S2 [1] (data from MRSA252) SA2041 (rpsC) 30S ribosomal protein S3 [1] (data from MRSA252) SAS052 (rpsD) 30S ribosomal protein S4 [1] (data from MRSA252) SA2031 (rpsE) 30S ribosomal protein S5 [1] (data from MRSA252) SA0352 (rpsF) 30S ribosomal protein S6 [1] (data from MRSA252) SA0504 (rpsG) 30S ribosomal protein S7 [1] (data from MRSA252) SA2034 (rpsH) 30S ribosomal protein S8 [1] (data from MRSA252) SA2016 (rpsI) 30S ribosomal protein S9 [1] (data from MRSA252) SA2048 (rpsJ) 30S ribosomal protein S10 [1] (data from MRSA252) SA2024 (rpsK) 30S ribosomal protein S11 [1] (data from MRSA252) SA2025 (rpsM) 30S ribosomal protein S13 [1] (data from MRSA252) SA1081 (rpsP) 30S ribosomal protein S16 [1] (data from MRSA252) SA0354 (rpsR) 30S ribosomal protein S18 [1] (data from MRSA252) SA2043 (rpsS) 30S ribosomal protein S19 [1] (data from MRSA252) SA0107 (spa) immunoglobulin G binding protein A [1] (data from MRSA252) SA1245 (sucA) 2-oxoglutarate dehydrogenase E1 [1] (data from MRSA252) SA1088 (sucC) succinyl-CoA synthetase subunit beta [1] (data from MRSA252) SA1506 (thrS) threonyl-tRNA synthetase [1] (data from MRSA252) SA1499 (tig) trigger factor [1] (data from MRSA252) SA1535 (tpx) thiol peroxidase [1] (data from MRSA252) SA0855 (trpS) tryptophanyl-tRNA synthetase [1] (data from MRSA252) SA1100 (tsf) elongation factor Ts [1] (data from MRSA252) SA0506 (tuf) elongation factor Tu [1] (data from MRSA252) SA1914 (upp) uracil phosphoribosyltransferase [1] (data from MRSA252) SA0422 hypothetical protein [1] (data from MRSA252) SA0466 hypothetical protein [1] (data from MRSA252) SA0477 pyridoxal biosynthesis lyase PdxS [1] (data from MRSA252) SA0537 phosphomethylpyrimidine kinase [1] (data from MRSA252) SA0587 hypothetical protein [1] (data from MRSA252) SA0707 hypothetical protein [1] (data from MRSA252) SA0774 hypothetical protein [1] (data from MRSA252) SA0802 hypothetical protein [1] (data from MRSA252) SA0829 hypothetical protein [1] (data from MRSA252) SA0873 hypothetical protein [1] (data from MRSA252) SA1069 hypothetical protein [1] (data from MRSA252) SA1224 hypothetical protein [1] (data from MRSA252) SA1272 alanine dehydrogenase [1] (data from MRSA252) SA1359 elongation factor P [1] (data from MRSA252) SA1365 glycine dehydrogenase subunit 2 [1] (data from MRSA252) SA1532 hypothetical protein [1] (data from MRSA252) SA1571 D-alanine aminotransferase [1] (data from MRSA252) SA1572 dipeptidase PepV [1] (data from MRSA252) SA1599 translaldolase [1] (data from MRSA252) SA1692 hypothetical protein [1] (data from MRSA252) SA1709 hypothetical protein [1] (data from MRSA252) SA1735 manganese-dependent inorganic pyrophosphatase [1] (data from MRSA252) SA1743 hypothetical protein [1] (data from MRSA252) SA1924 hypothetical protein [1] (data from MRSA252) SA2395 L-lactate dehydrogenase [1] (data from MRSA252) SA2399 fructose-1,6-bisphosphate aldolase [1] (data from MRSA252)
⊟Localization[edit | edit source]
- PSORTb: Cellwall
- Cytoplasmic Score: 0.01
- Cytoplasmic Membrane Score: 0.53
- Cellwall Score: 8.75
- Extracellular Score: 0.7
- Internal Helix: 1
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: 4
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.279228
- TAT(Tat/SPI): 0.000866
- LIPO(Sec/SPII): 0.048246
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKKELLEWIISIAVAFVILFIVGKFIVTPYTIKGESMDPTLKDGERVAVNIIGYKTGGLEKGNVVVFHANKNDDYVKRVIGVPGDKVEYKNDTLYVNGKKQDEPYLNYNLKHKQGDYITGTFQVKDLPNANPKSNVIPKGKYLVLGDNREVSKDSRAFGLIDEDQIVGKVSFRFWPFSEFKHNFNPENTKN
⊟Experimental data[edit | edit source]
- experimentally validated: no data available
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SA0824 > spsA > spsB
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.000 1.001 1.002 1.003 1.004 1.005 1.006 1.007 1.008 1.009 1.010 1.011 1.012 1.013 1.014 1.015 1.016 1.017 1.018 1.019 1.020 1.021 1.022 1.023 1.024 1.025 1.026 1.027 1.028 1.029 1.030 1.031 1.032 1.033 1.034 1.035 1.036 1.037 1.038 1.039 1.040 1.041 1.042 1.043 1.044 1.045 1.046 1.047 1.048 1.049 1.050 1.051 1.052 1.053 1.054 1.055 1.056 1.057 1.058 1.059 1.060 1.061 1.062 1.063 1.064 1.065 1.066 1.067 1.068 1.069 1.070 1.071 1.072 1.073 1.074 1.075 1.076 1.077 1.078 1.079 1.080 1.081 1.082 1.083 1.084 1.085 1.086 1.087 1.088 1.089 1.090 1.091 1.092 1.093 1.094 1.095 1.096 1.097 1.098 1.099 1.100 1.101 1.102 1.103 1.104 1.105 1.106 1.107 1.108 1.109 1.110 1.111 1.112 1.113 1.114 1.115 1.116 1.117 1.118 1.119 1.120 1.121 1.122 1.123 1.124
Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]