From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS03425 [old locus tag: SACOL0662 ]
  • pan locus tag?: SAUPAN002472000
  • symbol: SACOL_RS03425
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS03425 [old locus tag: SACOL0662 ]
  • symbol: SACOL_RS03425
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 690261..690644
  • length: 384
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (690261..690644) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    GTGTTGAAACAGCACAACGAAAAAGAAAAATTTGAATTTACTACTGAAGGAACTTGGCAA
    CAAAGGCAATCTAACTTTATTCGGTATGTAGAACAAATTGAGGATGCAACAGTTAATGTT
    ACAATAAAAGTGGATGATGATAGCGTTAAGTTGATTCGTAAAGGCGACATTAATATGAAT
    TTGCATTTTGTTGAAGGACAAACGACAACAACTTTTTACGATATATCGGCTGGACGAATT
    CCACTAGAAGTTAAAACATTACGCATTTTACATTTCGTAAGTGGAGACGGTGGCAAGCTA
    AAGATTCATTATGAATTATATCAAGATAATGAAAAAATGGGTTCTTATCAATATGAAATT
    AACTATAAGGAGATAGGCGAATGA
    60
    120
    180
    240
    300
    360
    384

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS03425 [old locus tag: SACOL0662 ]
  • symbol: SACOL_RS03425
  • description: hypothetical protein
  • length: 127
  • theoretical pI: 5.25318
  • theoretical MW: 14927.7
  • GRAVY: -0.714961

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:
  • PFAM:
    Calycin (CL0116) DUF1934; Domain of unknown function (DUF1934) (PF09148; HMM-score: 105.7)
    DUF4488; Domain of unknown function (DUF4488) (PF14869; HMM-score: 16.1)

Structure, modifications & interactions[edit source | edit]

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.136
    • Ymax_pos: 11
    • Cmax: 0.11
    • Cmax_pos: 67
    • Smax: 0.252
    • Smax_pos: 4
    • Smean: 0.176
    • D: 0.152
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI:
  • RefSeq: WP_001819741 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MLKQHNEKEKFEFTTEGTWQQRQSNFIRYVEQIEDATVNVTIKVDDDSVKLIRKGDINMNLHFVEGQTTTTFYDISAGRIPLEVKTLRILHFVSGDGGKLKIHYELYQDNEKMGSYQYEINYKEIGE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS03425 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.000 1.001 1.002 1.003 1.004 1.005 1.006 1.007 1.008 1.009 1.010 1.011 1.012 1.013 1.014 1.015 1.016 1.017 1.018 1.019 1.020 1.021 1.022 1.023 1.024 1.025 1.026 1.027 1.028 1.029 1.030 1.031 1.032 1.033 1.034 1.035 1.036 1.037 1.038 1.039 1.040 1.041 1.042 1.043 1.044 1.045 1.046 1.047 1.048 1.049 1.050 1.051 1.052 1.053 1.054 1.055 1.056 1.057 1.058 1.059 1.060 1.061 1.062 1.063 1.064 1.065 1.066 1.067 1.068 1.069 1.070 1.071 1.072 1.073 1.074 1.075 1.076 1.077 1.078 1.079 1.080 1.081 1.082 1.083 1.084 1.085 1.086 1.087 1.088 1.089 1.090 1.091 1.092 1.093 1.094 1.095 1.096 1.097 1.098 1.099 1.100

Relevant publications[edit source | edit]