From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_2439 [new locus tag: SAUSA300_RS13520 ]
  • pan locus tag?: SAUPAN006096000
  • symbol: galU
  • pan gene symbol?: gtaB
  • synonym:
  • product: UTP-glucose-1-phosphate uridylyltransferase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_2439 [new locus tag: SAUSA300_RS13520 ]
  • symbol: galU
  • product: UTP-glucose-1-phosphate uridylyltransferase
  • replicon: chromosome
  • strand: -
  • coordinates: 2628195..2628977
  • length: 783
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGCTTCCTATCTTAGATAAACCCACAATACAATATATCGTTGAAGAAGCTGCAAGAGCT
    GGAATTGAAGATATTATTATAGTGACAGGTCGCCACAAACGCGCGATTGAAGATCATTTT
    GATAGTCAAAAAGAATTAGAAATGGTGTTAAAAGAAAAAGGTAAATCTGAATTACTAGAG
    AAAGTTCAGTATTCAACGGAACTTGCGAATATTTTTTATGTAAGGCAGAAAGAACAAAAA
    GGTTTAGGGCATGCGATTAGTTCTGCGCGTCAATTTATCGGCAATGAACCATTTGCGGTA
    TTATTAGGTGACGATATTGTTGAATCTGAAGTGCCAGCAGTGAAACAGTTGATTGACGTT
    TATGAAGAAACAGGGCACTCAGTTATAGGTGTCCAAGAAGTTCCGGAAGCAGATACTCAT
    CGTTATGGAATTATTGACCCATTAACTAAAAACGGACGTCAGTATGAAGTGAAAAAGTTT
    GTTGAAAAGCCAGCACAAGGTACGGCACCATCAAACCTAGCTATTATGGGACGTTATGTA
    TTAACGCCTGAAATTTTCGATTATTTAAAAACGCAAAAAGAAGGCGCAGGTAACGAAATT
    CAGTTAACAGATGCGATTGAACGTATGAATAATGATAACCAAGTGTATGCATATGACTTC
    GAAGGCGAACGTTATGACGTTGGAGAAAAATTAGGCTTCGTTAAAACTACCATAGAATAT
    GCATTGAAAGATGACAGTATGCGAGAAGAATTAACACGATTTATTAAAGCATTAGGTTTA
    TAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    783

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_2439 [new locus tag: SAUSA300_RS13520 ]
  • symbol: GalU
  • description: UTP-glucose-1-phosphate uridylyltransferase
  • length: 260
  • theoretical pI: 4.65139
  • theoretical MW: 29458.2
  • GRAVY: -0.425769

Function[edit | edit source]

  • reaction:
    EC 2.7.7.9?  ExPASy
    UTP--glucose-1-phosphate uridylyltransferase UTP + alpha-D-glucose 1-phosphate = diphosphate + UDP-glucose
  • TIGRFAM:
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides UTP--glucose-1-phosphate uridylyltransferase (TIGR01099; EC 2.7.7.9; HMM-score: 340)
    and 12 more
    Signal transduction Regulatory functions Protein interactions regulatory protein GalF (TIGR01105; HMM-score: 166.5)
    glucose-1-phosphate thymidylyltransferase (TIGR01208; EC 2.7.7.24; HMM-score: 114.4)
    UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR03992; EC 2.3.1.157,2.7.7.23; HMM-score: 109.9)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides glucose-1-phosphate thymidylyltransferase (TIGR01207; EC 2.7.7.24; HMM-score: 47.6)
    Metabolism Energy metabolism Biosynthesis and degradation of polysaccharides glucose-1-phosphate adenylyltransferase (TIGR02091; EC 2.7.7.27; HMM-score: 44)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 40.9)
    Cell structure Cell envelope Biosynthesis and degradation of murein sacculus and peptidoglycan UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 40.9)
    Metabolism Central intermediary metabolism Amino sugars UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 40.9)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides glucose-1-phosphate cytidylyltransferase (TIGR02623; EC 2.7.7.33; HMM-score: 37.7)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase (TIGR01479; EC 2.7.7.13,5.3.1.8; HMM-score: 13.5)
    molybdenum cofactor cytidylyltransferase (TIGR03310; EC 2.7.7.76; HMM-score: 13.4)
    Hypothetical proteins Conserved TIGR00454 family protein (TIGR00454; HMM-score: 12.8)
  • TheSEED:  
    Cell Wall and Capsule Capsular and extracellular polysacchrides Streptococcal Hyaluronic Acid Capsule  UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9)
  • PFAM:
    GT-A (CL0110) NTP_transferase; Nucleotidyl transferase (PF00483; HMM-score: 98.7)
    and 3 more
    NTP_transf_3; MobA-like NTP transferase domain (PF12804; HMM-score: 26)
    Glycos_transf_2; Glycosyl transferase family 2 (PF00535; HMM-score: 14.1)
    no clan defined ATP-gua_PtransN; ATP:guanido phosphotransferase, N-terminal domain (PF02807; HMM-score: 12.6)

Structure, modifications & interactions[edit | edit source]

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005974
    • TAT(Tat/SPI): 0.000124
    • LIPO(Sec/SPII): 0.000399
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MLPILDKPTIQYIVEEAARAGIEDIIIVTGRHKRAIEDHFDSQKELEMVLKEKGKSELLEKVQYSTELANIFYVRQKEQKGLGHAISSARQFIGNEPFAVLLGDDIVESEVPAVKQLIDVYEETGHSVIGVQEVPEADTHRYGIIDPLTKNGRQYEVKKFVEKPAQGTAPSNLAIMGRYVLTPEIFDYLKTQKEGAGNEIQLTDAIERMNNDNQVYAYDFEGERYDVGEKLGFVKTTIEYALKDDSMREELTRFIKALGL

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

  • galU no polycistronic organisation predicted

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. 1.000 1.001 1.002 1.003 1.004 1.005 1.006 1.007 1.008 1.009 1.010 1.011 1.012 1.013 1.014 1.015 1.016 1.017 1.018 1.019 1.020 1.021 1.022 1.023 1.024 1.025 1.026 1.027 1.028 1.029 1.030 1.031 1.032 1.033 1.034 1.035 1.036 1.037 1.038 1.039 1.040 1.041 1.042 1.043 1.044 1.045 1.046 1.047 1.048 1.049 1.050 1.051 1.052 1.053 1.054 1.055 1.056 1.057 1.058 1.059 1.060 1.061 1.062 1.063 1.064 1.065 1.066 1.067 1.068 1.069 1.070 1.071 1.072 1.073 1.074 1.075 1.076 1.077 1.078 1.079 1.080 1.081 1.082 1.083 1.084 1.085 1.086 1.087 1.088 1.089 1.090 1.091 1.092 1.093 1.094 1.095 1.096 1.097 1.098 1.099 1.100 1.101 1.102 1.103 1.104 1.105 1.106 1.107 1.108 1.109 1.110 1.111 1.112 1.113 1.114 1.115 1.116 1.117 1.118 1.119 1.120 1.121 1.122 1.123 1.124 1.125 1.126 1.127 1.128 1.129 1.130 1.131 1.132 1.133 1.134 1.135 1.136 1.137 1.138 1.139 1.140 1.141 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]