Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0862 [new locus tag: SACOL_RS04425 ]
- pan locus tag?: SAUPAN002803000
- symbol: SACOL0862
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0862 [new locus tag: SACOL_RS04425 ]
- symbol: SACOL0862
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 889449..889667
- length: 219
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238550 NCBI
- RefSeq: YP_185735 NCBI
- BioCyc: see SACOL_RS04425
- MicrobesOnline: 912335 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAGTGAATGGCATATTAATAATCAATCTACAAAACCTTTTTTAATACAACAAGCGGAA
AAGCAATTGTCTATTGTTAAACCGTTGCCTAATGGTAGCTTCCAAATACTCACAGAAATA
AATTTGGAGAATGGCAATATTAGTAACATCGATCATTCTTTACTTGTTTCAGTAGACCCC
AAAGCATTAGAAATAAGTATATTTGACGCTGTAAATTAA60
120
180
219
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0862 [new locus tag: SACOL_RS04425 ]
- symbol: SACOL0862
- description: hypothetical protein
- length: 72
- theoretical pI: 4.53222
- theoretical MW: 8043.08
- GRAVY: -0.111111
⊟Function[edit | edit source]
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.6701
- Cytoplasmic Membrane Score: 0.2306
- Cell wall & surface Score: 0.0004
- Extracellular Score: 0.0988
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00264
- TAT(Tat/SPI): 0.000126
- LIPO(Sec/SPII): 0.000263
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSEWHINNQSTKPFLIQQAEKQLSIVKPLPNGSFQILTEINLENGNISNIDHSLLVSVDPKALEISIFDAVN
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
SACOL1760 (ackA) acetate kinase [1] (data from MRSA252) SACOL1385 (acnA) aconitate hydratase [1] (data from MRSA252) SACOL0660 (adhP) alcohol dehydrogenase [1] (data from MRSA252) SACOL0452 (ahpC) alkyl hydroperoxide reductase subunit C [1] (data from MRSA252) SACOL1758 (ald2) alanine dehydrogenase [1] (data from MRSA252) SACOL0663 (argS) arginyl-tRNA synthetase [1] (data from MRSA252) SACOL1494 (asnC) asparaginyl-tRNA synthetase [1] (data from MRSA252) SACOL1786 (ccpA) catabolite control protein A [1] (data from MRSA252) SACOL1735 (coaE) dephospho-CoA kinase [1] (data from MRSA252) SACOL1272 (codY) transcriptional repressor CodY [1] (data from MRSA252) SACOL0557 (cysK) cysteine synthase [1] (data from MRSA252) SACOL2074 (ddl) D-alanyl-alanine synthetase A [1] (data from MRSA252) SACOL0123 (deoC1) deoxyribose-phosphate aldolase [1] (data from MRSA252) SACOL2130 (deoD) purine nucleoside phosphorylase [1] (data from MRSA252) SACOL0937 (dltC) D-alanine--poly(phosphoribitol) ligase subunit 2 [1] (data from MRSA252) SACOL1637 (dnaK) molecular chaperone DnaK [1] (data from MRSA252) SACOL1587 (efp) elongation factor P [1] (data from MRSA252) SACOL0842 (eno) phosphopyruvate hydratase [1] (data from MRSA252) SACOL0988 (fabF) 3-oxoacyl-ACP synthase [1] (data from MRSA252) SACOL1245 (fabG1) 3-oxoacyl-ACP reductase [1] (data from MRSA252) SACOL2117 (fbaA) fructose-bisphosphate aldolase [1] (data from MRSA252) SACOL2622 (fdaB) fructose-1,6-bisphosphate aldolase [1] (data from MRSA252) SACOL1329 (femC) glutamine synthetase [1] (data from MRSA252) SACOL1782 (fhs) formate--tetrahydrofolate ligase [1] (data from MRSA252) SACOL1199 (ftsZ) cell division protein FtsZ [1] (data from MRSA252) SACOL0593 (fusA) elongation factor G [1] (data from MRSA252) SACOL0838 (gapA1) glyceraldehyde 3-phosphate dehydrogenase [1] (data from MRSA252) SACOL1734 (gapA2) glyceraldehyde 3-phosphate dehydrogenase 2 [1] (data from MRSA252) SACOL1960 (gatB) aspartyl/glutamyl-tRNA amidotransferase subunit B [1] (data from MRSA252) SACOL0877 (gcvH) glycine cleavage system protein H [1] (data from MRSA252) SACOL2145 (glmS) glucosamine--fructose-6-phosphate aminotransferase [1] (data from MRSA252) SACOL1742 (gltA) citrate synthase [1] (data from MRSA252) SACOL1622 (glyS) glycyl-tRNA synthetase [1] (data from MRSA252) SACOL1554 (gnd) 6-phosphogluconate dehydrogenase [1] (data from MRSA252) SACOL2016 (groEL) chaperonin GroEL [1] (data from MRSA252) SACOL0460 (guaB) inosine-5'-monophosphate dehydrogenase [1] (data from MRSA252) SACOL1513 (hup) DNA-binding protein HU [1] (data from MRSA252) SACOL1727 (infC) translation initiation factor IF-3 [1] (data from MRSA252) SACOL0222 (ldh1) L-lactate dehydrogenase [1] (data from MRSA252) SACOL1054 (menB) naphthoate synthase [1] (data from MRSA252) SACOL2623 (mqo2) malate:quinone oxidoreductase [1] (data from MRSA252) SACOL2149 (mtlD) mannitol-1-phosphate 5-dehydrogenase [1] (data from MRSA252) SACOL2116 (murAB) UDP-N-acetylglucosamine 1-carboxyvinyltransferase [1] (data from MRSA252) SACOL1285 (nusA) transcription elongation factor NusA [1] (data from MRSA252) SACOL1102 (pdhA) pyruvate dehydrogenase complex E1 component subunit alpha [1] (data from MRSA252) SACOL1103 (pdhB) pyruvate dehydrogenase complex E1 component subunit beta [1] (data from MRSA252) SACOL1104 (pdhC) branched-chain alpha-keto acid dehydrogenase E2 [1] (data from MRSA252) SACOL1105 (pdhD) dihydrolipoamide dehydrogenase [1] (data from MRSA252) SACOL2128 (pdp) pyrimidine-nucleoside phosphorylase [1] (data from MRSA252) SACOL0204 (pflB) formate acetyltransferase [1] (data from MRSA252) SACOL0966 (pgi) glucose-6-phosphate isomerase [1] (data from MRSA252) SACOL0839 (pgk) phosphoglycerate kinase [1] (data from MRSA252) SACOL0841 (pgm) phosphoglyceromutase [1] (data from MRSA252) SACOL1091 (ptsH) phosphocarrier protein HPr [1] (data from MRSA252) SACOL1745 (pyk) pyruvate kinase [1] (data from MRSA252) SACOL0584 (rplA) 50S ribosomal protein L1 [1] (data from MRSA252) SACOL2236 (rplB) 50S ribosomal protein L2 [1] (data from MRSA252) SACOL2239 (rplC) 50S ribosomal protein L3 [1] (data from MRSA252) SACOL2227 (rplE) 50S ribosomal protein L5 [1] (data from MRSA252) SACOL2224 (rplF) 50S ribosomal protein L6 [1] (data from MRSA252) SACOL0015 (rplI) 50S ribosomal protein L9 [1] (data from MRSA252) SACOL0585 (rplJ) 50S ribosomal protein L10 [1] (data from MRSA252) SACOL0586 (rplL) 50S ribosomal protein L7/L12 [1] (data from MRSA252) SACOL2207 (rplM) 50S ribosomal protein L13 [1] (data from MRSA252) SACOL2220 (rplO) 50S ribosomal protein L15 [1] (data from MRSA252) SACOL2232 (rplP) 50S ribosomal protein L16 [1] (data from MRSA252) SACOL2212 (rplQ) 50S ribosomal protein L17 [1] (data from MRSA252) SACOL1702 (rplU) 50S ribosomal protein L21 [1] (data from MRSA252) SACOL2234 (rplV) 50S ribosomal protein L22 [1] (data from MRSA252) SACOL2237 (rplW) 50S ribosomal protein L23 [1] (data from MRSA252) SACOL0588 (rpoB) DNA-directed RNA polymerase subunit beta [1] (data from MRSA252) SACOL0589 (rpoC) DNA-directed RNA polymerase subunit beta' [1] (data from MRSA252) SACOL2120 (rpoE) DNA-directed RNA polymerase subunit delta [1] (data from MRSA252) SACOL2233 (rpsC) 30S ribosomal protein S3 [1] (data from MRSA252) SACOL1769 (rpsD) 30S ribosomal protein S4 [1] (data from MRSA252) SACOL2222 (rpsE) 30S ribosomal protein S5 [1] (data from MRSA252) SACOL2206 (rpsI) 30S ribosomal protein S9 [1] (data from MRSA252) SACOL2214 (rpsK) 30S ribosomal protein S11 [1] (data from MRSA252) SACOL2230 (rpsQ) 30S ribosomal protein S17 [1] (data from MRSA252) SACOL2235 (rpsS) 30S ribosomal protein S19 [1] (data from MRSA252) SACOL0009 (serS) seryl-tRNA synthetase [1] (data from MRSA252) SACOL1610 (sodA2) superoxide dismutase [1] (data from MRSA252) SACOL0095 (spa) immunoglobulin G binding protein A precursor [1] (data from MRSA252) SACOL1449 (sucA) 2-oxoglutarate dehydrogenase E1 component [1] (data from MRSA252) SACOL1448 (sucB) dihydrolipoamide succinyltransferase [1] (data from MRSA252) SACOL1262 (sucC) succinyl-CoA synthetase subunit beta [1] (data from MRSA252) SACOL1263 (sucD) succinyl-CoA synthetase subunit alpha [1] (data from MRSA252) SACOL1831 (tal) translaldolase [1] (data from MRSA252) SACOL1729 (thrS) threonyl-tRNA synthetase [1] (data from MRSA252) SACOL1722 (tig) trigger factor [1] (data from MRSA252) SACOL1377 (tkt) transketolase [1] (data from MRSA252) SACOL1762 (tpx) thiol peroxidase [1] (data from MRSA252) SACOL0829 (trxB) thioredoxin-disulfide reductase [1] (data from MRSA252) SACOL1276 (tsf) elongation factor Ts [1] (data from MRSA252) SACOL0594 (tuf) elongation factor Tu [1] (data from MRSA252) SACOL0426 acetyl-CoA acetyltransferase [1] (data from MRSA252) SACOL0457 hypothetical protein [1] (data from MRSA252) SACOL0521 hypothetical protein [1] (data from MRSA252) SACOL0564 pyridoxal biosynthesis lyase PdxS [1] (data from MRSA252) SACOL0633 heme peroxidase [1] (data from MRSA252) SACOL0707 dihydroxyacetone kinase subunit DhaK [1] (data from MRSA252) SACOL0721 hypothetical protein [1] (data from MRSA252) SACOL0815 ribosomal subunit interface protein [1] (data from MRSA252) SACOL0876 hypothetical protein [1] (data from MRSA252) SACOL0914 FeS assembly ATPase SufC [1] (data from MRSA252) SACOL0944 NADH dehydrogenase [1] (data from MRSA252) SACOL0973 fumarylacetoacetate hydrolase [1] (data from MRSA252) SACOL1098 hypothetical protein [1] (data from MRSA252) SACOL1205 hypothetical protein [1] (data from MRSA252) SACOL1427 ABC transporter ATP-binding protein [1] (data from MRSA252) SACOL1437 CSD family cold shock protein [1] (data from MRSA252) SACOL1594 glycine dehydrogenase subunit 1 [1] (data from MRSA252) SACOL1753 universal stress protein [1] (data from MRSA252) SACOL1759 universal stress protein [1] (data from MRSA252) SACOL2114 aldehyde dehydrogenase [1] (data from MRSA252) SACOL2173 alkaline shock protein 23 [1] (data from MRSA252) SACOL2296 glycerate dehydrogenase [1] (data from MRSA252) SACOL2367 alcohol dehydrogenase, zinc-containing [1] (data from MRSA252) SACOL2561 hydroxymethylglutaryl-CoA synthase [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: SigB* (activation) regulon
SigB* (sigma factor) controlling a large regulon involved in stress/starvation response and adaptation; [2] other strains
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.000 1.001 1.002 1.003 1.004 1.005 1.006 1.007 1.008 1.009 1.010 1.011 1.012 1.013 1.014 1.015 1.016 1.017 1.018 1.019 1.020 1.021 1.022 1.023 1.024 1.025 1.026 1.027 1.028 1.029 1.030 1.031 1.032 1.033 1.034 1.035 1.036 1.037 1.038 1.039 1.040 1.041 1.042 1.043 1.044 1.045 1.046 1.047 1.048 1.049 1.050 1.051 1.052 1.053 1.054 1.055 1.056 1.057 1.058 1.059 1.060 1.061 1.062 1.063 1.064 1.065 1.066 1.067 1.068 1.069 1.070 1.071 1.072 1.073 1.074 1.075 1.076 1.077 1.078 1.079 1.080 1.081 1.082 1.083 1.084 1.085 1.086 1.087 1.088 1.089 1.090 1.091 1.092 1.093 1.094 1.095 1.096 1.097 1.098 1.099 1.100 1.101 1.102 1.103 1.104 1.105 1.106 1.107 1.108 1.109 1.110 1.111 1.112 1.113 1.114 1.115 1.116 1.117 1.118 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p) - ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
J Bacteriol: 2004, 186(13);4085-99
[PubMed:15205410] [WorldCat.org] [DOI] (P p)