From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_0595 [new locus tag: SAUSA300_RS03200 ]
  • pan locus tag?: SAUPAN002472000
  • symbol: SAUSA300_0595
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_0595 [new locus tag: SAUSA300_RS03200 ]
  • symbol: SAUSA300_0595
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 668792..669175
  • length: 384
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    GTGTTGAAACAGCACAACGAAAAAGAAAAATTTGAATTTACTACTGAAGGAACTTGGCAA
    CAAAGGCAATCTAACTTTATTCGGTATGTAGAACAAATTGAGGATGCAACAGTTAATGTT
    ACAATAAAAGTGGATGATGATAGCGTTAAGTTGATTCGTAAAGGCGACATTAATATGAAT
    TTGCATTTTGTTGAAGGACAAACGACAACAACTTTTTACGATATATCGGCTGGACGAATT
    CCACTAGAAGTTAAAACATTACGCATTTTACATTTCGTAAGTGGAGACGGTGGCAAGCTA
    AAGATTCATTATGAATTATATCAAGATAATGAAAAAATGGGTTCTTATCAATATGAAATT
    AACTATAAGGAGATAGGCGAATGA
    60
    120
    180
    240
    300
    360
    384


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAUSA300_0595 [new locus tag: SAUSA300_RS03200 ]
  • symbol: SAUSA300_0595
  • description: hypothetical protein
  • length: 127
  • theoretical pI: 5.25318
  • theoretical MW: 14927.7
  • GRAVY: -0.714961

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • hypothetical fig|282458.1.peg.583 homolog
  • PFAM:
    Calycin (CL0116) DUF1934; Domain of unknown function (DUF1934) (PF09148; HMM-score: 106.9)
    and 4 more
    DUF4488; Domain of unknown function (DUF4488) (PF14869; HMM-score: 15.4)
    EF_hand (CL0220) EF-hand_FSTL1; Follistatin-related protein 1, EF-hand domain pair (PF23564; HMM-score: 15.4)
    Gal_mutarotase (CL0103) AmyA-gluTrfs_C; Alpha-amylase/4-alpha-glucanotransferase, C-terminal (PF09095; HMM-score: 14.8)
    Cupin (CL0029) Cupin_3; EutQ-like cupin domain (PF05899; HMM-score: 13.4)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9847
    • Cytoplasmic Membrane Score: 0.0135
    • Cell wall & surface Score: 0.0009
    • Extracellular Score: 0.0009
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005257
    • TAT(Tat/SPI): 0.000591
    • LIPO(Sec/SPII): 0.001116
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MLKQHNEKEKFEFTTEGTWQQRQSNFIRYVEQIEDATVNVTIKVDDDSVKLIRKGDINMNLHFVEGQTTTTFYDISAGRIPLEVKTLRILHFVSGDGGKLKIHYELYQDNEKMGSYQYEINYKEIGE

⊟Experimental data[edit | edit source]

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ 1.000 1.001 1.002 1.003 1.004 1.005 1.006 1.007 1.008 1.009 1.010 1.011 1.012 1.013 1.014 1.015 1.016 1.017 1.018 1.019 1.020 1.021 1.022 1.023 1.024 1.025 1.026 1.027 1.028 1.029 1.030 1.031 1.032 1.033 1.034 1.035 1.036 1.037 1.038 1.039 1.040 1.041 1.042 1.043 1.044 1.045 1.046 1.047 1.048 1.049 1.050 1.051 1.052 1.053 1.054 1.055 1.056 1.057 1.058 1.059 1.060 1.061 1.062 1.063 1.064 1.065 1.066 1.067 1.068 1.069 1.070 1.071 1.072 1.073 1.074 1.075 1.076 1.077 1.078 1.079 1.080 1.081 1.082 1.083 1.084 1.085 1.086 1.087 1.088 1.089 1.090 1.091 1.092 1.093 1.094 1.095 1.096 1.097 1.098 1.099 1.100 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]