From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01396
  • pan locus tag?: SAUPAN003808000
  • symbol: SAOUHSC_01396
  • pan gene symbol?: dapA
  • synonym:
  • product: 4-hydroxy-tetrahydrodipicolinate synthase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_01396
  • symbol: SAOUHSC_01396
  • product: 4-hydroxy-tetrahydrodipicolinate synthase
  • replicon: chromosome
  • strand: +
  • coordinates: 1339088..1339975
  • length: 888
  • essential: no [1] DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGACACATTTATTTGAGGGTGTTGGCGTTGCACTTACAACCCCTTTTACAAATAACAAA
    GTTAATATTGAAGCTTTGAAAACACACGTTAATTTTTTACTAGAAAATAATGCCCAAGCA
    ATCATCGTTAATGGAACTACTGCTGAGAGCCCTACTTTAACAACAGATGAAAAAGAACGC
    ATTCTAAAAACAGTTATTGATCTTGTAGATAAACGTGTTCCTGTCATAGCAGGAACTGGC
    ACTAATGATACTGAAAAGTCAATCCAAGCTTCAATCCAAGCTAAAGCCTTAGGGGCTGAT
    GCAATTATGTTAATTACGCCCTACTACAACAAAACGAACCAACGTGGTTTAGTCAAACAC
    TTTGAAGCGATTGCAGATGCTGTGAAATTACCAGTCGTGCTGTACAATGTTCCTTCAAGA
    ACGAACATGACAATTGAACCAGAAACTGTAGAAATATTAAGTCAACATCCTTATATAGTT
    GCTTTAAAAGATGCTACGAATGATTTTGAGTATTTAGAAGAAGTGAAAAAGCGCATTGAT
    ACAAATTCATTTGCATTATATAGTGGCAATGATGACAACGTCGTCGAATACTATCAACGT
    GGCGGTCAAGGGGTTATCTCTGTTATTGCCAATGTCATTCCTAAAGAATTTCAAGCGTTA
    TACGATGCTCAACAAAGTGGATTAGATATTCAAGATCAATTTAAACCAATCGGCACACTG
    TTATCAGCTTTATCAGTTGATATTAACCCAATTCCTATTAAAGCTCTAACAAGTTATTTA
    GGATTTGGAAATTATGAATTACGTCTACCATTGGTTAGCCTAGAAGATACAGATACTAAA
    GTGCTTCGTGAAACATATGACACATTTAAAGCGGGTGAAAATGAGTGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    888

Protein[edit source | edit]

Protein Data Bank: 3DI0
Protein Data Bank: 3DI1

General[edit source | edit]

  • locus tag: SAOUHSC_01396
  • symbol: SAOUHSC_01396
  • description: 4-hydroxy-tetrahydrodipicolinate synthase
  • length: 295
  • theoretical pI: 4.5405
  • theoretical MW: 32583.7
  • GRAVY: -0.155254

Function[edit source | edit]

  • reaction:
    EC 4.3.3.7?  ExPASy
    4-hydroxy-tetrahydrodipicolinate synthasePyruvate + L-aspartate-4-semialdehyde = (4S)-4-hydroxy-2,3,4,5-tetrahydro-(2S)-dipicolinate + H2O
  • TIGRFAM:
    MetabolismAmino acid biosynthesisAspartate family4-hydroxy-tetrahydrodipicolinate synthase (TIGR00674; EC 4.3.3.7; HMM-score: 282)
    2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase (TIGR02313; EC 4.1.2.-; HMM-score: 193.2)
    5-dehydro-4-deoxyglucarate dehydratase (TIGR03249; EC 4.2.1.41; HMM-score: 110.3)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesN-acetylneuraminate lyase (TIGR00683; EC 4.1.3.3; HMM-score: 96.8)
    MetabolismCentral intermediary metabolismAmino sugarsN-acetylneuraminate lyase (TIGR00683; EC 4.1.3.3; HMM-score: 96.8)
    Hypothetical proteinsConservedTIGR01244 family protein (TIGR01244; HMM-score: 13.8)
    MetabolismAmino acid biosynthesisSerine familyputative phosphoserine aminotransferase (TIGR01366; EC 2.6.1.52; HMM-score: 13.2)
  • TheSEED:  
    Amino Acids and DerivativesLysine, threonine, methionine, and cysteineLysine Biosynthesis DAP Pathway 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) 
  • PFAM:
    TIM_barrel (CL0036) DHDPS; Dihydrodipicolinate synthetase family (PF00701; HMM-score: 250.8)
    Tubulin_C (CL0442) FtsZ_C; FtsZ family, C-terminal domain (PF12327; HMM-score: 15.3)
    TIM_barrel (CL0036) NMO; Nitronate monooxygenase (PF03060; HMM-score: 13.6)
    SIS (CL0067) SIS; SIS domain (PF01380; HMM-score: 13.3)

Structure, modifications & interactions[edit source | edit]

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.202
    • Ymax_pos: 26
    • Cmax: 0.212
    • Cmax_pos: 41
    • Smax: 0.333
    • Smax_pos: 20
    • Smean: 0.22
    • D: 0.209
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTHLFEGVGVALTTPFTNNKVNIEALKTHVNFLLENNAQAIIVNGTTAESPTLTTDEKERILKTVIDLVDKRVPVIAGTGTNDTEKSIQASIQAKALGADAIMLITPYYNKTNQRGLVKHFEAIADAVKLPVVLYNVPSRTNMTIEPETVEILSQHPYIVALKDATNDFEYLEEVKKRIDTNSFALYSGNDDNVVEYYQRGGQGVISVIANVIPKEFQALYDAQQSGLDIQDQFKPIGTLLSALSVDINPIPIKALTSYLGFGNYELRLPLVSLEDTDTKVLRETYDTFKAGENE

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: SAOUHSC_01228 (CodY*)
    CodY* (TF) important in Amino acid metabolism  RegPrecise    transcription unit transferred from N315 data RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 2.000 2.001 2.002 2.003 2.004 2.005 2.006 2.007 2.008 2.009 2.010 2.011 2.012 2.013 2.014 2.015 2.016 2.017 2.018 2.019 2.020 2.021 2.022 2.023 2.024 2.025 2.026 2.027 2.028 2.029 2.030 2.031 2.032 2.033 2.034 2.035 2.036 2.037 2.038 2.039 2.040 2.041 2.042 2.043 2.044 2.045 2.046 2.047 2.048 2.049 2.050 2.051 2.052 2.053 2.054 2.055 2.056 2.057 2.058 2.059 2.060 2.061 2.062 2.063 2.064 2.065 2.066 2.067 2.068 2.069 2.070 2.071 2.072 2.073 2.074 2.075 2.076 2.077 2.078 2.079 2.080 2.081 2.082 2.083 2.084 2.085 2.086 2.087 2.088 2.089 2.090 2.091 2.092 2.093 2.094 2.095 2.096 2.097 2.098 2.099 2.100 2.101 2.102 2.103 2.104 2.105 2.106 2.107 2.108 2.109 2.110 2.111

Relevant publications[edit source | edit]